Property Summary

NCBI Gene PubMed Count 59
PubMed Score 231.14
PubTator Score 45.08

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Gene RIF (37)

PMID Text
26169395 the binding of SGTA to Rpn13 enables specific polypeptides to escape proteasomal degradation and/or selectively modulates substrate degradation.
25415308 Data show that molecular chaperone BAG6_ubiquitin-like domain (UBL) and ubiquitin-like 4A UBL4A_UBL compete for the same binding site on N-terminal dimerisation domain of SGTA protein (SGTA_NT).
25179605 data suggest that SGTA regulates the cellular fate of a range of hydrophobic polypeptides should they become exposed to the cytosol.
25027991 SGTA overexpression may be involved in the pathogenesis of breast cancer which might serve as a future target for novel treatment in breast cancer.
24974147 A role of SGTA in Non-Hodgkin's lymphoma (NHL) cell proliferation, adhesion and drug resistance, and it may pave the way for a novel therapeutic approach for cell adhesion-mediated drug resistance in NHL.
24753260 Our data suggest a role for SGTA at distinct steps in the chaperone-dependent modulation of androgen, glucocorticoid, and progesterone receptor activity.
24195513 Univariate analysis showed that the low SGTB expression was associated with poor prognosis (P<0.001)
23939810 High expression of SGTA in esophageal squamous cell carcinoma correlates with proliferation and poor prognosis.
23857189 High Small glutamine-rich tetratricopeptide repeat-containing protein alpha expression is associated with non-small-cell lung cancer tumorigenesis.
23839012 SGTA depletion decreased cyclin A and cyclin B levels.
23740762 showed a significant increase in the AR:SGTA ratio in cancerous lesions compared to patient-matched benign prostatic hyperplasia tissue
23433514 SGTA is present in human ovaries and has the potential to modulate androgen receptor signalling, but it may not be differentially expressed in polycystic ovary syndrome.
23246001 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.
23142665 Structures of the Sgt2/SGTA dimerization domain with the Get5/UBL4A UBL domain reveal an interaction that forms a conserved dynamic interface.
23129660 A BAG6/SGTA cycle operates during protein maturation and quality control in the cytosol.
22733359 findings show that the HERV-K(HML-2) Rec protein binds to hSGT and interferes with its role as a negative regulator of the androgen receptor (AR), resulting in enhanced AR activity
22693264 Homodimerizaion of SGTA is dependent on the structural integrity of amino acids 1-80, and a core evolutionary conserved peptide within this region (amino acids 21-40) necessary for an effect of SGTA on the activity of the androgen receptor.
20200332 Observational study of gene-disease association. (HuGE Navigator)
20012522 Residues 84-210 in SGT and residues 31-35 in HIV-1 Vpu are required for the binding of Vpu to SGT
18759457 The TPR domain of SGT can bind Vpu and reduce the amount of HIV-1 virus p24, which is the viral capsid, secreted from cells transfected with the HIV-1 proviral construct.
18759457 Residues 84-210 in SGT and residues 31-35 in HIV-1 Vpu are required for the binding of Vpu to SGT
18607086 The recombinant human small glutamine-rich tetratricopeptide-repeat protein SGT has been purified and crystallized and preliminary analysis of the tetratricopeptide-repeat (TPR) domain is reported.
18332089 For SNP rs1640262, homozygotes for minor allele were protected against PCOS. Haplotype 1 (G-A-T) associated with increased risk of PCOS. In PCOS, haplotype 2 (A-G-C) associated with increased insulin resistance, resulting in increased insulin secretion.
18332089 Observational study of gene-disease association. (HuGE Navigator)
17942943 SGTA acts as a rheostat of androgen receptor signaling in prostate cancer
16777091 Interaction of hSGT with Hsc70, Hsp70 or Bag-6/Bat-3/Scythe was demonstrated in prometaphase, thereby suggesting a possible role for complexes containing hSGT and distinct (co)-chaperones during mitosis.
16580629 the sub-cellular localization of SGT was closely associated with Hsp90beta and apoptosis
15972823 CSP modulates G protein function by preferentially targeting the inactive GDP-bound form of G alpha(s) and promoting GDP/GTP exchange; the guanine nucleotide exchange activity of full-length CSP is regulated by Hsc70-SGT
15710426 SGT is a new pro-apoptotic factor
14729056 SGTA (or hSGT) is essential for cell division. Knock down experiments show that cells with reduced levels of SGTA arrest in mitosis and die while undergoing cell division.
12815268 Complete backbone assignments of the 121 residues of hSGT were determined and deposited in BMRB 5709.
12735788 interaction with the ubiquitin-dependent endocytosis motif of the growth hormone receptor
12482202 small glutamine-rich protein/viral protein U-binding protein (SGT/UBP) is a cochaperone that negatively regulates Hsp70.
11878889 Residues 84-210 in SGT and residues 31-35 in HIV-1 Vpu are required for the binding of Vpu to SGT
9766974 Residues 84-210 in SGT and residues 31-35 in HIV-1 Vpu are required for the binding of Vpu to SGT
9573291 Residues 84-210 in SGT and residues 31-35 in HIV-1 Vpu are required for the binding of Vpu to SGT
7966229 Residues 84-210 in SGT and residues 31-35 in HIV-1 Vpu are required for the binding of Vpu to SGT

AA Sequence

MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKE      1 - 70
MPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGN     71 - 140
YAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREAP    141 - 210
SPTGGVGSFDIAGLLNNPGFMSMASNLMNNPQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQF    211 - 280
AQQMQQQNPELIEQLRSQIRSRTPSASNDDQQE                                         281 - 313
//

Text Mined References (69)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26169395 2015 Binding of SGTA to Rpn13 selectively modulates protein quality control.
25416956 2014 A proteome-scale map of the human interactome network.
25415308 2014 Solution structure of the SGTA dimerisation domain and investigation of its interactions with the ubiquitin-like domains of BAG6 and UBL4A.
25179605 2014 SGTA regulates the cytosolic quality control of hydrophobic substrates.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25027991 2014 Expression and prognostic role of SGTA in human breast carcinoma correlates with tumor cell proliferation.
24974147 2014 Expression of small glutamine-rich TPR-containing protein A (SGTA) in Non-Hodgkin's Lymphomas promotes tumor proliferation and reverses cell adhesion-mediated drug resistance (CAM-DR).
24753260 2014 The cochaperone SGTA (small glutamine-rich tetratricopeptide repeat-containing protein alpha) demonstrates regulatory specificity for the androgen, glucocorticoid, and progesterone receptors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24195513 2014 Decreased expression of Small glutamine-rich tetratricopeptide repeat-containing protein (SGT) correlated with prognosis of Hepatocellular carcinoma.
23939810 2014 High expression of SGTA in esophageal squamous cell carcinoma correlates with proliferation and poor prognosis.
23857189 2013 Expression and clinical role of small glutamine-rich tetratricopeptide repeat (TPR)-containing protein alpha (SGTA) as a novel cell cycle protein in NSCLC.
23839012 2014 Expression of SGTA correlates with prognosis and tumor cell proliferation in human hepatocellular carcinoma.
23740762 2013 Knockdown of the cochaperone SGTA results in the suppression of androgen and PI3K/Akt signaling and inhibition of prostate cancer cell proliferation.
23433514 2013 Small glutamine-rich tetratricopeptide repeat-containing protein alpha is present in human ovaries but may not be differentially expressed in relation to polycystic ovary syndrome.
23246001 2012 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142665 2012 Structures of the Sgt2/SGTA dimerization domain with the Get5/UBL4A UBL domain reveal an interaction that forms a conserved dynamic interface.
23129660 2012 SGTA antagonizes BAG6-mediated protein triage.
22733359 2013 The Rec protein of HERV-K(HML-2) upregulates androgen receptor activity by binding to the human small glutamine-rich tetratricopeptide repeat protein (hSGT).
22693264 2012 Subdomain structure of the co-chaperone SGTA and activity of its androgen receptor client.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18759457 2008 Structural and functional characterization of human SGT and its interaction with Vpu of the human immunodeficiency virus type 1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18607086 2008 Expression, purification and preliminary crystallographic analysis of recombinant human small glutamine-rich tetratricopeptide-repeat protein.
18332089 2008 Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA), a candidate gene for polycystic ovary syndrome.
17942943 2007 Control of androgen receptor signaling in prostate cancer by the cochaperone small glutamine rich tetratricopeptide repeat containing protein alpha.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17034881 2007 Cysteine-string protein isoform beta (Cspbeta) is targeted to the trans-Golgi network as a non-palmitoylated CSP in clonal beta-cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16777091 2006 Human SGT interacts with Bag-6/Bat-3/Scythe and cells with reduced levels of either protein display persistence of few misaligned chromosomes and mitotic arrest.
16580632 2006 Severe acute respiratory syndrome coronavirus protein 7a interacts with hSGT.
16580629 2006 SGT, a Hsp90beta binding partner, is accumulated in the nucleus during cell apoptosis.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15972823 2005 Characterization of the G alpha(s) regulator cysteine string protein.
15710426 2005 Overexpression of small glutamine-rich TPR-containing protein promotes apoptosis in 7721 cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14729056 2004 The human small glutamine-rich TPR-containing protein is required for progress through cell division.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14623262 2003 hSGT interacts with the N-terminal region of myostatin.
12815268 2003 1H, 15N and 13C resonance assignments of the tetratricopeptide repeat (TPR) domain of hSGT.
12735788 2003 Small glutamine-rich tetratricopeptide repeat-containing protein (SGT) interacts with the ubiquitin-dependent endocytosis (UbE) motif of the growth hormone receptor.
12482202 2002 Small glutamine-rich protein/viral protein U-binding protein is a novel cochaperone that affects heat shock protein 70 activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11878889 2001 Association of Vpu-binding protein with microtubules and Vpu-dependent redistribution of HIV-1 Gag protein.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10567422 1999 Specific interaction of the 70-kDa heat shock cognate protein with the tetratricopeptide repeats.
9766974 1998 Functional interaction of human immunodeficiency virus type 1 Vpu and Gag with a novel member of the tetratricopeptide repeat protein family.
9740675 1998 Isolation and characterization of human SGT and identification of homologues in Saccharomyces cerevisiae and Caenorhabditis elegans.
9573291 1998 Functional interaction of human immunodeficiency virus type 1 Vpu and Gag with a novel member of the tetratricopeptide repeat protein family.
9557704 1998 Identification of a novel cellular TPR-containing protein, SGT, that interacts with the nonstructural protein NS1 of parvovirus H-1.
7966229 Cell type-dependence for Vpu function.
2158125 1990 Peptide analogs of thymopentin distinguish distinct thymopoietin receptor specificities on two human T cell lines.