Property Summary

NCBI Gene PubMed Count 35
PubMed Score 151.78
PubTator Score 81.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Mucopolysaccharidosis III 7 0.0 5.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Mucopolysaccharidosis 26 7.506 3.8
Disease Target Count
Sanfilippo syndrome type A 2

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.7e-07
atypical teratoid / rhabdoid tumor 1.300 1.9e-06
group 4 medulloblastoma 1.100 2.7e-05
malignant mesothelioma -1.300 1.0e-05
ovarian cancer 2.600 2.0e-08
subependymal giant cell astrocytoma 1.490 1.4e-02

Protein-protein Interaction (6)

Gene RIF (12)

AA Sequence

MSCPVPACCALLLVLGLCRARPRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSC      1 - 70
SPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTE     71 - 140
ENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDW    141 - 210
TPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPS    211 - 280
GRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLP    281 - 350
ALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQP    351 - 420
TGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEK    421 - 490
LSPQCQPLHNEL                                                              491 - 502
//

Text Mined References (43)

PMID Year Title