Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.96
PubTator Score 5.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
urothelial carcinoma -2.400 5.0e-05
astrocytic glioma -2.100 1.3e-03
oligodendroglioma -1.600 1.1e-02
glioblastoma -2.200 3.7e-05
osteosarcoma -1.061 3.6e-04
ependymoma -1.100 3.6e-03
medulloblastoma -2.900 3.0e-08
medulloblastoma, large-cell -1.800 2.0e-02
primitive neuroectodermal tumor -2.100 7.5e-04
primary pancreatic ductal adenocarcinoma 2.502 1.0e-04
tuberculosis -2.200 2.7e-05
non-small cell lung cancer 1.793 2.7e-11
intraductal papillary-mucinous adenoma (... 1.400 3.3e-02
intraductal papillary-mucinous carcinoma... 2.200 6.0e-03
intraductal papillary-mucinous neoplasm ... 2.500 8.5e-03
pancreatic cancer 2.500 1.5e-07
interstitial cystitis -2.200 2.8e-05
lung adenocarcinoma 1.300 4.0e-07
adult high grade glioma -2.600 1.3e-07
atypical teratoid/rhabdoid tumor -1.100 2.5e-02
pilocytic astrocytoma -2.100 3.9e-08
subependymal giant cell astrocytoma -2.677 8.2e-03
Endometriosis -2.259 4.5e-02
spina bifida -1.472 2.8e-02
Pick disease 1.300 2.5e-03
ductal carcinoma in situ 1.900 6.0e-03
invasive ductal carcinoma 3.000 1.1e-02
ovarian cancer -1.100 2.2e-03

 GWAS Trait (1)

Gene RIF (3)

PMID Text
24274704 SGPP2, a sphingosine-1-phosphate phosphatase, is a novel vitamin D-responsive gene associated with lung function.
17113265 This study provides detailed insights into the regulation of SPP2 gene expression and suggests that SPP2 might be a novel player in pro-inflammatory signalling.
12411432 characterization of SPP2, another member of the SPP family that may play a role in attenuating intracellular S1P signaling.

AA Sequence

MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGEAPANGLRRAA      1 - 70
APEAYVQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLK     71 - 140
WPRPSSPPVVKLEKRLIAEYGMPSTHAMAATAIAFTLLISTMDRYQYPFVLGLVMAVVFSTLVCLSRLYT    141 - 210
GMHTVLDVLGGVLITALLIVLTYPAWTFIDCLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTI    211 - 280
LAAGAGVTIGFWINHFFQLVSKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL    281 - 350
YSWFKVVTRNKEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP                         351 - 399
//

Text Mined References (10)

PMID Year Title
26494556 2015 Tumor suppressor microRNA-31 inhibits gastric carcinogenesis by targeting Smad4 and SGPP2.
24274704 2013 Vitamin D-responsive SGPP2 variants associated with lung cell expression and lung function.
23568457 2013 Genetic variants associated with disordered eating.
22277765 2012 Sphingosine pathway deregulation in endometriotic tissues.
17113265 2007 Sphingosine 1-phosphate phosphatase 2 is induced during inflammatory responses.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411432 2003 Identification and characterization of a novel human sphingosine-1-phosphate phosphohydrolase, hSPP2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.