Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.89
PubTator Score 10.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.600 1.0e-04
osteosarcoma 3.469 9.6e-06
chronic lymphosyte leukemia 2.100 1.2e-09
pancreatic ductal adenocarcinoma liver m... -1.566 5.7e-03
colon cancer -1.300 3.1e-03
Breast cancer 2.000 4.2e-02
primary Sjogren syndrome 1.400 2.5e-03
aldosterone-producing adenoma -1.756 2.8e-02
Pick disease -1.300 4.8e-04
ovarian cancer -2.400 8.1e-05
Down syndrome 1.100 1.4e-03
head and neck cancer and chronic obstruc... 1.100 2.6e-03

Gene RIF (11)

PMID Text
26239167 The two gastric cancer cells transfected with pEF-SGPP1 exhibited a slower rate of growth with less adhesion. Thus, our findings provided evidence that SGPP1 may serve as a prognostic biomarker for patients with advanced gastric cancers.
25166914 Study has revealed miR-27a as a tumor suppressor and has identified SGPP1 and Smad2 as novel targets of miR-27a, linking to STAT3 for regulating cancer cell proliferation, apoptosis and migration in colorectal cancer.
24145350 The sphingolipid phosphatase SGPP1, an antagonist of sphingosine-1-phosphate signaling, is a target of miR-95 that promotes radiation resistance.
22106015 S1P is elevated in patients with IPF, correlates with the lung function and mediates EMT.
22052905 doxorubicin switches protective autophagy in SPP1-depleted cells to apoptosis by calpain-mediated Atg5 cleavage.
21940944 Under normal circumstances, the retinal vascular pericytes maintain pericyte-endothelial contacts and vascular barrier function through the secretion of sphingosine 1-phosphate.
20798685 SPP1 by regulating intracellular S1P homeostasis, can control the UPR and ER stress-induced autophagy.
17895250 Sphingosine kinase 2, but not sphingosine kinase 1, acted in concert with SPP-1 to regulate recycling of sphingosine into ceramide.
16782891 SPP-1 regulates ceramide levels in the ER and thus influences the anterograde membrane transport of both ceramide and proteins from the ER to the Golgi apparatus.
15180992 sphingosine-1-phosphate phosphatase 1 has a role in epidermal growth factor-induced chemotaxis
12815058 sphingosine-1-phosphate phosphatase 1 plays roles in the regulation of intra- and extracellular sphingosine-1-phosphate levels and cell viability

AA Sequence

MSLRQRLAQLVGRLQDPQKVARFQRLCGVEAPPRRSADRREDEKAEAPLAGDPRLRGRQPGAPGGPQPPG      1 - 70
SDRNQCPAKPDGGGAPNGVRNGLAAELGPASPRRAGALRRNSLTGEEGQLARVSNWPLYCLFCFGTELGN     71 - 140
ELFYILFFPFWIWNLDPLVGRRLVVIWVLVMYLGQCTKDIIRWPRPASPPVVKLEVFYNSEYSMPSTHAM    141 - 210
SGTAIPISMVLLTYGRWQYPLIYGLILIPCWCSLVCLSRIYMGMHSILDIIAGFLYTILILAVFYPFVDL    211 - 280
IDNFNQTHKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVTYNMGLVLDPSLDTL    281 - 350
PLAGPPITVTLFGKAILRILIGMVFVLIIRDVMKKITIPLACKIFNIPCDDIRKARQHMEVELPYRYITY    351 - 420
GMVGFSITFFVPYIFFFIGIS                                                     421 - 441
//

Text Mined References (29)

PMID Year Title
26239167 2015 Inhibition of sphingosine-1-phosphate phosphatase 1 promotes cancer cells migration in gastric cancer: Clinical implications.
25166914 2014 Tumor suppressor microRNA-27a in colorectal carcinogenesis and progression by targeting SGPP1 and Smad2.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145350 2013 miRNA-95 mediates radioresistance in tumors by targeting the sphingolipid phosphatase SGPP1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
22106015 2012 Sphingosine-1-phosphate is increased in patients with idiopathic pulmonary fibrosis and mediates epithelial to mesenchymal transition.
22052905 2011 Autophagy induced by deficiency of sphingosine-1-phosphate phosphohydrolase 1 is switched to apoptosis by calpain-mediated autophagy-related gene 5 (Atg5) cleavage.
21940944 2011 Pericyte-derived sphingosine 1-phosphate induces the expression of adhesion proteins and modulates the retinal endothelial cell barrier.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20798685 2011 Sphingosine-1-phosphate phosphohydrolase-1 regulates ER stress-induced autophagy.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19798445 2009 Genetic determinants of circulating sphingolipid concentrations in European populations.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17895250 2007 Recycling of sphingosine is regulated by the concerted actions of sphingosine-1-phosphate phosphohydrolase 1 and sphingosine kinase 2.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16782891 2006 Sphingosine-1-phosphate phosphohydrolase regulates endoplasmic reticulum-to-golgi trafficking of ceramide.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15180992 2004 Role of sphingosine-1-phosphate phosphatase 1 in epidermal growth factor-induced chemotaxis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815058 2003 Role of human sphingosine-1-phosphate phosphatase 1 in the regulation of intra- and extracellular sphingosine-1-phosphate levels and cell viability.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411432 2003 Identification and characterization of a novel human sphingosine-1-phosphate phosphohydrolase, hSPP2.
10859351 2000 Molecular cloning and characterization of a lipid phosphohydrolase that degrades sphingosine-1- phosphate and induces cell death.