Property Summary

Ligand Count 17
NCBI Gene PubMed Count 39
PubMed Score 109.53
PubTator Score 1923.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.100 1.6e-02
Astrocytoma, Pilocytic 1.200 7.6e-07
glioblastoma 1.100 4.4e-05
group 3 medulloblastoma 1.100 3.0e-03
interstitial cystitis -1.300 1.7e-03
intraductal papillary-mucinous carcinoma... 1.100 4.8e-02
invasive ductal carcinoma 1.118 4.7e-04
lung cancer 2.500 1.2e-04
lung carcinoma 1.500 2.4e-29
non-small cell lung cancer 1.198 1.1e-23
ovarian cancer 2.000 4.8e-05
pituitary cancer 1.200 2.0e-04
posterior fossa group A ependymoma 1.100 1.2e-07
X-linked cerebral adrenoleukodystrophy 1.300 3.3e-02

Protein-protein Interaction (3)

Gene RIF (28)

AA Sequence

MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRF      1 - 70
KKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFW     71 - 140
QEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGG    141 - 210
TESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNT    211 - 280
AMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISAD    281 - 350
THKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEAT    351 - 420
KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLL    421 - 490
HARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQ    491 - 560
MNGSPKPH                                                                  561 - 568
//

Text Mined References (44)

PMID Year Title