Property Summary

NCBI Gene PubMed Count 31
PubMed Score 102.79
PubTator Score 1923.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.400 1.8e-03
glioblastoma 1.100 4.4e-05
non-small cell lung cancer 1.514 7.9e-25
intraductal papillary-mucinous carcinoma... 1.100 4.8e-02
X-linked cerebral adrenoleukodystrophy 1.300 3.3e-02
lung cancer 2.800 6.0e-06
interstitial cystitis -1.700 1.2e-05
group 3 medulloblastoma 1.100 3.0e-03
pilocytic astrocytoma 1.200 8.9e-07
posterior fossa group A ependymoma 1.100 1.2e-07
invasive ductal carcinoma 1.200 4.1e-03
lung carcinoma 1.500 2.4e-29
ovarian cancer 3.300 5.0e-07
pituitary cancer 1.200 2.0e-04

Protein-protein Interaction (3)

Gene RIF (20)

PMID Text
26886371 increased SK and SPL mRNA expression along with reduced sphingosine 1-phosphate levels were more commonly observed in hepatocellular carcinoma tissues.
26493335 SPHK1:SGPL1 ratio correlated with increased cellular sphingosine-1-phosphate (S1P), and S1P correlated with drug resistance (IC50).
25785436 Results show that dissociation of SHP-1 from spinophilin is followed by an increase in the binding of spinophilin to PP1.
25347472 Sphingosine-1-phosphate lyase downregulation promotes colon carcinogenesis through STAT3-activated microRNAs.
24825162 The cells expressing SGPL1 in the parenchyma were CD68(+) APCs.
24704119 S1P lyase - by facilitating S1P1 receptor recycling - is essential for S1P-mediated sustained signaling
24468113 results highlight the importance of S1P in AD suggesting the existence of a global deregulation of S1P signaling in this disease from its synthesis by SphK1 and degradation by SPL to its signaling by the S1P1 receptor.
24323699 Data show that a easy assay for 2-hydroxyacyl-CoA lyase (HACL1) and sphingosine-1-phosphate lyase (SGPL1) activities was developed.
22784711 SPL expression and activity are downregulated in cancerous tissues, there is a relationship between loss of SPL expression and prostate cancer aggressiveness.
22190034 HIV-1 Vpu is identified to have a physical interaction with sphingosine-1-phosphate lyase 1 (SGPL1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21368890 S1P lyase regulates DNA damage responses through a sphingolipid feedback mechanism.
21304987 S1P(ext) mediated endothelial cell motility is dependent on intracellular S1P production, which is regulated, in part, by SphK1 and S1PL.
21184844 high SPL transcription of H1155 cells was regulated by Sp1 and GATA-4/Sp1 complex formation, both of which bind to Sp1 sites of the 5'-SPL promoter.
20519401 Overexpression of sphingosine 1-phosphate lyase (SPL), which induces the degradation of sphingosine 1-phosphate, interfered with the amplification of infectious influenza virus.
19119317 Data suggest that lymphocyte trafficking is particularly sensitive to variations in sphingosine 1-phosphate lyase (S1PL) activity and suggest that there is a window in which partial inhibition of S1PL could produce therapeutic levels of immunosuppression.
18172856 extracellular S1P is dephosphorylated and subsequently converted by cells, which appears to be important for clearance of the signaling molecule S1P in the local tissue environment after infections or injuries
17373700 Observational study of gene-disease association. (HuGE Navigator)
17090686 genetic or epigenetic changes affecting intestinal sphingosine-1-phosphate metabolism may correlate with and potentially contribute to carcinogenesis
16385451 Observational study of gene-disease association. (HuGE Navigator)
14570870 sphingosine-1-phosphate lyase is a dual modulator of sphingosine 1-phosphate and ceramide metabolism as well as a regulator of cell fate decisions

AA Sequence

MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRF      1 - 70
KKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFW     71 - 140
QEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGG    141 - 210
TESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNT    211 - 280
AMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISAD    281 - 350
THKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEAT    351 - 420
KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLL    421 - 490
HARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQ    491 - 560
MNGSPKPH                                                                  561 - 568
//

Text Mined References (36)

PMID Year Title
26886371 2016 Increased mRNA Levels of Sphingosine Kinases and S1P Lyase and Reduced Levels of S1P Were Observed in Hepatocellular Carcinoma in Association with Poorer Differentiation and Earlier Recurrence.
26493335 2015 Regulation of cellular sphingosine-1-phosphate by sphingosine kinase 1 and sphingosine-1-phopshate lyase determines chemotherapy resistance in gastroesophageal cancer.
25785436 2015 Dissociation of SHP-1 from spinophilin during platelet activation exposes an inhibitory binding site for protein phosphatase-1 (PP1).
25347472 2014 Sphingosine-1-phosphate lyase downregulation promotes colon carcinogenesis through STAT3-activated microRNAs.
24825162 2014 Sphingosine-1-phosphate lyase is expressed by CD68+ cells on the parenchymal side of marginal reticular cells in human lymph nodes.
24809814 2014 Orally active 7-substituted (4-benzylphthalazin-1-yl)-2-methylpiperazin-1-yl]nicotinonitriles as active-site inhibitors of sphingosine 1-phosphate lyase for the treatment of multiple sclerosis.
24704119 2014 Sphingosine-1-phosphate (S1P) displays sustained S1P1 receptor agonism and signaling through S1P lyase-dependent receptor recycling.
24468113 2014 Reduced sphingosine kinase-1 and enhanced sphingosine 1-phosphate lyase expression demonstrate deregulated sphingosine 1-phosphate signaling in Alzheimer's disease.
24323699 2014 RP-HPLC-fluorescence analysis of aliphatic aldehydes: application to aldehyde-generating enzymes HACL1 and SGPL1.
22784711 2012 First evidence of sphingosine 1-phosphate lyase protein expression and activity downregulation in human neoplasm: implication for resistance to therapeutics in prostate cancer.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21368890 2011 S1P lyase regulates DNA damage responses through a novel sphingolipid feedback mechanism.
21304987 2011 Intracellular S1P generation is essential for S1P-induced motility of human lung endothelial cells: role of sphingosine kinase 1 and S1P lyase.
21269460 2011 Initial characterization of the human central proteome.
21184844 2011 Heterogeneous sphingosine-1-phosphate lyase gene expression and its regulatory mechanism in human lung cancer cell lines.
20519401 2010 Sphingosine 1-phosphate-metabolizing enzymes control influenza virus propagation and viral cytopathogenicity.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19119317 2009 Incomplete inhibition of sphingosine 1-phosphate lyase modulates immune system function yet prevents early lethality and non-lymphoid lesions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18172856 2008 S1P-lyase independent clearance of extracellular sphingosine 1-phosphate after dephosphorylation and cellular uptake.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
17090686 2006 Sphingosine-1-phosphate lyase potentiates apoptosis via p53- and p38-dependent pathways and is down-regulated in colon cancer.
16777052 2006 Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14570870 2004 Sphingosine-phosphate lyase enhances stress-induced ceramide generation and apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11018465 2000 Human sphingosine-1-phosphate lyase: cDNA cloning, functional expression studies and mapping to chromosome 10q22(1).
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9464245 1998 Identification of the first mammalian sphingosine phosphate lyase gene and its functional expression in yeast.
2061324 1991 Subcellular localization and membrane topology of sphingosine-1-phosphate lyase in rat liver.