Property Summary

NCBI Gene PubMed Count 19
PubMed Score 24.77
PubTator Score 39.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 1.500 4.8e-02
hepatocellular carcinoma 1.100 6.8e-04
osteosarcoma 3.175 2.2e-03
posterior fossa group B ependymoma 2.100 2.4e-06
non diabetic and post-ischemic heart fai... -1.200 3.2e-02
atypical teratoid / rhabdoid tumor 1.800 2.6e-02
medulloblastoma, large-cell 1.200 2.1e-04
tuberculosis -1.200 1.7e-03
non-small cell lung cancer -2.145 6.3e-16
intraductal papillary-mucinous neoplasm ... 1.800 1.9e-02
active Crohn's disease 1.121 9.0e-03
active ulcerative colitis 1.355 2.6e-02
lung adenocarcinoma -1.200 2.6e-09
group 3 medulloblastoma -1.500 4.9e-03
nasopharyngeal carcinoma -2.500 2.9e-05
lung carcinoma -2.200 9.7e-17
spina bifida -2.705 8.1e-03
Breast cancer -1.800 1.1e-06
ovarian cancer 3.700 1.7e-06
pituitary cancer -3.600 2.8e-08

Gene RIF (15)

PMID Text
25231990 F-actin polymerization in the region of HIV-1 membrane fusion was more prominent in Sms2-expressing cells than Sms-deficient cells.
25231990 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
22106271 Data indicate that the increased sphingomyelin mass was due to a rapid and highly specific activation of sphingomyelin synthases SMS1 and SMS2.
21980337 SMS1 and SMS2 are capable of regulating TGN-mediated protein trafficking and secretion
21235823 direct morphological evidence for the pro-atherogenic capabilities of sphingomyelin synthase 2
20332099 Observational study of gene-disease association. (HuGE Navigator)
19454763 Data show that SMS2 acting as a bifunctional enzyme with both SM and CPE synthase activity.
19286635 Sphingomyelin synthase 2 is one of the determinants for plasma and liver sphingomyelin levels in mice.
19233134 These results suggested that posttranslational palmitoylation is important for determination of the subcellular localization of SMS2.
18694848 Both SMS1 and SMS2 contain two histidines and one aspartic acid which are conserved within the lipid phosphate phosphatase superfamily. Site-directed mutagenesis of these amino acids abolished SMS activity without altering cellular distribution.
18566297 SMS2 (Sphingomyelin synthase 2) physiologically contributes to de novo Sphingomyelin biosynthesis and plasma membrane Sphingomyelin levels
18370930 SMS2 regulates subcellular pools of diacylglycerol-binding proteins in the Golgi apparatus.
17982138 SMS2 is a key factor in control of sphingomyelin and diacylglycerol metabolism within the cell, and thus it influences apoptosis.
17616479 Results indicate that both synthase (SMS)1 and 2 contribute to sphingomyelin (SM) de novo synthesis and control SM levels in the cells and on the cell membrane including plasma membrane.
17449912 Data show that sphingomyelin synthases SMS1 and SMS2 are co-expressed in a variety of cell types and function as the key Golgi- and plasma membrane-associated SM synthases in human cervical carcinoma HeLa cells, respectively.

AA Sequence

MDIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRN      1 - 70
KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDYIDRVKWAFSVSEINGIILVG     71 - 140
LWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQAKVQRILRLISGG    141 - 210
GLSITGSHILCGDFLFSGHTVTLTLTYLFIKEYSPRHFWWYHLICWLLSAAGIICILVAHEHYTIDVIIA    211 - 280
YYITTRLFWWYHSMANEKNLKVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKK    281 - 350
YSRVQKIGEDNEKST                                                           351 - 365
//

Text Mined References (22)

PMID Year Title
25231990 2014 Sphingomyelin synthase 2, but not sphingomyelin synthase 1, is involved in HIV-1 envelope-mediated membrane fusion.
22106271 2011 Sphingomyelin and sphingomyelin synthase (SMS) in the malignant transformation of glioma cells and in 2-hydroxyoleic acid therapy.
21980337 2011 Sphingomyelin synthases regulate protein trafficking and secretion.
21235823 2011 Adenovirus-mediated sphingomyelin synthase 2 increases atherosclerotic lesions in ApoE KO mice.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19454763 2009 Sphingomyelin synthase SMS2 displays dual activity as ceramide phosphoethanolamine synthase.
19286635 2009 Sphingomyelin synthase 2 is one of the determinants for plasma and liver sphingomyelin levels in mice.
19233134 2009 Sphingomyelin synthase 2 is palmitoylated at the COOH-terminal tail, which is involved in its localization in plasma membranes.
19001565 2008 An inositolphosphorylceramide synthase is involved in regulation of plant programmed cell death associated with defense in Arabidopsis.
18694848 2008 The domain responsible for sphingomyelin synthase (SMS) activity.
18566297 2008 Sphingomyelin synthase 2 deficiency attenuates NFkappaB activation.
18370930 2008 Sphingomyelin synthases regulate production of diacylglycerol at the Golgi.
17982138 2008 SMS overexpression and knockdown: impact on cellular sphingomyelin and diacylglycerol metabolism, and cell apoptosis.
17616479 2007 Inhibition of sphingomyelin synthase (SMS) affects intracellular sphingomyelin accumulation and plasma membrane lipid organization.
17449912 2007 Both sphingomyelin synthases SMS1 and SMS2 are required for sphingomyelin homeostasis and growth in human HeLa cells.
16508036 2006 Adenovirus-mediated overexpression of sphingomyelin synthases 1 and 2 increases the atherogenic potential in mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685263 2004 Identification of a family of animal sphingomyelin synthases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.