Property Summary

NCBI Gene PubMed Count 45
PubMed Score 51.83
PubTator Score 24.25

Knowledge Summary

Patent (12,531)

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma -1.800 2.9e-04
medulloblastoma, large-cell -2.500 2.1e-05
intraductal papillary-mucinous carcinoma... -1.100 9.8e-04
breast carcinoma 1.300 1.1e-03
Pick disease -1.100 2.1e-03
progressive supranuclear palsy -1.700 1.4e-02
ovarian cancer -1.800 5.7e-09

Protein-protein Interaction (6)

Gene RIF (30)

PMID Text
26573229 Data show that activation of serum- and glucocorticoid-regulated kinase 3 (SGK3) plays an important role in inositol polyphosphate 4-phosphatase type II (INPP4B)-mediated melanoma cell proliferation.
25837824 It is unlikely that SGK3 plays a significant role for oncogenic signalling in multiple myeloma.
25712345 SGK3 is a key mediator of PDK1 activity in melanoma.
25458846 Breast cancers harboring oncogenic PIK3CA activate SGK3 signaling while suppressing Akt, indicative of oncogenic functions for both INPP4B and SGK3 in these tumors.
25395352 VPS34-IN1 will provide a useful tool to decipher the kinase-dependent functions of Vps34, with acute changes in SGK3 phosphorylation and subcellular localization being new biomarkers of Vps34 activity
24739041 SGK3 is an androgen receptor (AR) target and induces cell proliferation through the AR-SGK3-p70S6K-cyclin D1 pathway in prostate cancer cells.
24556932 SGK3 is a novel regulator of K(ir)2.1.
24379398 SGK3 stability and kinase activation are regulated by the Hsp90-Cdc37 chaperone complex.
23589291 SGK1,3 enhances the expression level of mature hERG channels by inhibiting Nedd4-2 as well as by promoting Rab11-mediated hERG recycling.
22576469 A positive correlation between SGK3 expression and breast tumor prognosis.
22262416 found that expression of SGK3, which like AKT is activated by PI3K/PDK1 signaling, has more significance than overexpression of AKT in predicting poor outcome in hepatocellular carcinoma patients
21084382 SGK3 is an estrogen receptor (ER) transcriptional target and promotes estrogen-mediated cell survival of ER-positive breast cancer cells.
20687898 SGK3 is not required for insulin-induced PFK-2 activation and that this effect is likely mediated by PKBalpha.
20511718 Glucocorticoid inducible kinase isoforms SGK1-3 are novel potent stimulators of Slc6a19 and may thus participate in the regulation of neutral amino acid transport in vivo.
19293151 These findings support the model that CISK phosphorylates FLII and activates nuclear receptor transcription and suggest a new cell survival signaling pathway mediated by PI 3-kinase and CISK.
17167223 SGK3 participates in the regulation of HERG by increasing HERG protein abundance in the plasma membrane and may thus modify the duration of the cardiac action potential.
16888620 CISK plays an important role in specifically attenuating ubiquitin-dependent degradation of CXCR4, and provide a mechanistic link between the PI 3-kinase pathway and CXCR4 stability.
16790420 Targeting of SGK3 to endosomes, mediated by its Phox homology domain, is essential for proper SGK3 activation.
16485113 SGK3 and stargazin regulate GluR1 independently, and thus, their effects on glutamate-induced currents are additive.
16036218 SGK1 and SGK3 increase SLC6A8 activity by increasing the maximal transport rate of the carrier. Deranged SGK1 and/or SGK3 dependent regulation of SLC6A8 may affect energy storage particularly in skeletal muscle, heart, and neurons
15737648 In conclusion, the kinases SGK1 and SGK3 increase EAAT5 activity by increasing cell surface abundance of the carrier.
15578212 Co-expression of SGK1, but not of SGK2 or SGK3, increased Kv 4.3/KChIP2b channel currents.
15496163 ClC-Ka/barttin channels are regulated by SGK1 and SGK3, which may thus participate in the regulation of transport in kidney and inner ear.
14604990 peroxisomal targeting signal (PTS)-tagged CISK with deleted PX domain was able to direct 3-phosphoinositide-dependent protein kinase-1 (PDK-1) into peroxisomes
12634932 All three members of the SGK family of kinases SGK1-3 and protein kinase B stimulate the slowly activating K(+) channel KCNE1/KCNQ1. The kinases may thus participate in the regulation of KCNE1-dependent transport and excitability.
12632189 SGK2 and SGK3 mimic the function of SGK1 and are likely to participate in the regulation of ENaC activity.
12590200 The stimulating effect of SGK1 on the Xenopus oocyte Na(+)/K(+)-ATPase is mimicked by the isoforms SGK2 and SGK3
12397388 Powerful stimulating effect of all three isoforms of SGK on K(+) channels. Those effects may participate in regulation of epithelial transport, cell proliferation, and neuromuscular excitability.
12218062 low steady-state expression level of SGK-1 is due to polyubiquitination and subsequent degradation by the 26S proteasome
12054501 Human serum and glucocorticoid-inducible kinase-like kinase (SGKL) phosphorylates glycogen syntheses kinase 3 beta (GSK-3beta) at serine-9 through direct interaction

AA Sequence

MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMAL      1 - 70
KIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKL     71 - 140
HSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAE    141 - 210
RNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSI    211 - 280
KIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAV    281 - 350
LYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE    351 - 420
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP    421 - 490
SEDLFL                                                                    491 - 496
//

Text Mined References (57)

PMID Year Title
26573229 2015 INPP4B is upregulated and functions as an oncogenic driver through SGK3 in a subset of melanomas.
25837824 2015 Loss of serum and glucocorticoid-regulated kinase 3 (SGK3) does not affect proliferation and survival of multiple myeloma cell lines.
25712345 2015 PDK1 and SGK3 Contribute to the Growth of BRAF-Mutant Melanomas and Are Potential Therapeutic Targets.
25458846 2014 SGK3 mediates INPP4B-dependent PI3K signaling in breast cancer.
25395352 2014 Cinderella finds her shoe: the first Vps34 inhibitor uncovers a new PI3K-AGC protein kinase connection.
24739041 2014 SGK3 is an androgen-inducible kinase promoting prostate cancer cell proliferation through activation of p70 S6 kinase and up-regulation of cyclin D1.
24556932 2014 Up-regulation of Kir2.1 (KCNJ2) by the serum & glucocorticoid inducible SGK3.
24379398 2014 Coordinated regulation of serum- and glucocorticoid-inducible kinase 3 by a C-terminal hydrophobic motif and Hsp90-Cdc37 chaperone complex.
23589291 2013 The serum- and glucocorticoid-inducible kinases SGK1 and SGK3 regulate hERG channel expression via ubiquitin ligase Nedd4-2 and GTPase Rab11.
22576469 2012 SGK3 is associated with estrogen receptor expression in breast cancer.
22262416 2012 Serum and glucocorticoid kinase 3 at 8q13.1 promotes cell proliferation and survival in hepatocellular carcinoma.
21865597 2011 Serum- and glucocorticoid-induced kinase 3 in recycling endosomes mediates acute activation of Na+/H+ exchanger NHE3 by glucocorticoids.
21084382 2011 SGK3 is an estrogen-inducible kinase promoting estrogen-mediated survival of breast cancer cells.
20919962 2010 Second AKT: the rise of SGK in cancer signalling.
20687898 2010 Heart 6-phosphofructo-2-kinase activation by insulin requires PKB (protein kinase B), but not SGK3 (serum- and glucocorticoid-induced protein kinase 3).
20511718 2010 The serum and glucocorticoid inducible kinases SGK1-3 stimulate the neutral amino acid transporter SLC6A19.
19293151 2009 Identification of Flightless-I as a substrate of the cytokine-independent survival kinase CISK.
18005662 2007 Regulation of the epithelial calcium channel TRPV6 by the serum and glucocorticoid-inducible kinase isoforms SGK1 and SGK3.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17167223 2006 Upregulation of HERG channels by the serum and glucocorticoid inducible kinase isoform SGK3.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16888620 2006 CISK attenuates degradation of the chemokine receptor CXCR4 via the ubiquitin ligase AIP4.
16790420 2006 Role of the Phox homology domain and phosphorylation in activation of serum and glucocorticoid-regulated kinase-3.
16543730 2006 DOCA-induced phosphorylation of glycogen synthase kinase 3beta.
16485113 2006 Additive regulation of GluR1 by stargazin and serum- and glucocorticoid-inducible kinase isoform SGK3.
16460280 2006 Sgk kinases and their role in epithelial transport.
16341674 2005 Transcriptome analysis of human gastric cancer.
16036218 2005 Stimulation of the creatine transporter SLC6A8 by the protein kinases SGK1 and SGK3.
15845389 2005 The serine/threonine kinases SGK1, 3 and PKB stimulate the amino acid transporter ASCT2.
15737648 2005 Regulation of the excitatory amino acid transporter EAAT5 by the serum and glucocorticoid dependent kinases SGK1 and SGK3.
15578212 2005 Regulation of cardiac shal-related potassium channel Kv 4.3 by serum- and glucocorticoid-inducible kinase isoforms in Xenopus oocytes.
15496163 2004 Regulation of CLC-Ka/barttin by the ubiquitin ligase Nedd4-2 and the serum- and glucocorticoid-dependent kinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15319523 2004 Regulation of the epithelial Ca2+ channel TRPV5 by the NHE regulating factor NHERF2 and the serum and glucocorticoid inducible kinase isoforms SGK1 and SGK3 expressed in Xenopus oocytes.
15044175 2004 Regulation of intestinal phosphate cotransporter NaPi IIb by ubiquitin ligase Nedd4-2 and by serum- and glucocorticoid-dependent kinase 1.
15040001 2004 Regulation of the voltage gated K+ channel Kv1.3 by the ubiquitin ligase Nedd4-2 and the serum and glucocorticoid inducible kinase SGK1.
14706641 2004 Stimulation of renal Na+ dicarboxylate cotransporter 1 by Na+/H+ exchanger regulating factor 2, serum and glucocorticoid inducible kinase isoforms, and protein kinase B.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14604990 2004 Peroxisomal targeting as a tool for assaying potein-protein interactions in the living cell: cytokine-independent survival kinase (CISK) binds PDK-1 in vivo in a phosphorylation-dependent manner.
12911626 2003 Regulation of the glutamate transporter EAAT1 by the ubiquitin ligase Nedd4-2 and the serum and glucocorticoid-inducible kinase isoforms SGK1/3 and protein kinase B.
12650886 2003 Serum and glucocorticoid inducible kinases in the regulation of the cardiac sodium channel SCN5A.
12634932 2003 Regulation of KCNE1-dependent K(+) current by the serum and glucocorticoid-inducible kinase (SGK) isoforms.
12632189 2003 The serine/threonine kinases SGK2 and SGK3 are potent stimulators of the epithelial Na+ channel alpha,beta,gamma-ENaC.
12590200 2002 Activation of Na+/K+-ATPase by the serum and glucocorticoid-dependent kinase isoforms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397388 2002 K+ channel activation by all three isoforms of serum- and glucocorticoid-dependent protein kinase SGK.
12218062 2002 Ubiquitin modification of serum and glucocorticoid-induced protein kinase-1 (SGK-1).
12054501 2002 Human serum and glucocorticoid-inducible kinase-like kinase (SGKL) phosphorylates glycogen syntheses kinase 3 beta (GSK-3beta) at serine-9 through direct interaction.
11884598 2002 Convergence of multiple signaling cascades at glycogen synthase kinase 3: Edg receptor-mediated phosphorylation and inactivation by lysophosphatidic acid through a protein kinase C-dependent intracellular pathway.
11751930 2002 Glucocorticoid activation of Na(+)/H(+) exchanger isoform 3 revisited. The roles of SGK1 and NHERF2.
11749387 2001 Glycogen synthase kinase-3: properties, functions, and regulation.
11707620 2001 Regulation and physiological roles of serum- and glucocorticoid-induced protein kinase isoforms.
11514587 2001 Regulation of cytokine-independent survival kinase (CISK) by the Phox homology domain and phosphoinositides.
11035810 2000 Phosphorylation and inactivation of glycogen synthase kinase 3 by protein kinase A.
10585774 1999 Cloning and mapping of a novel human serum/glucocorticoid regulated kinase-like gene, SGKL, to chromosome 8q12.3-q13.1.
10548550 1999 Characterization of the structure and regulation of two novel isoforms of serum- and glucocorticoid-induced protein kinase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.