Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.78
PubTator Score 3.30

Knowledge Summary

Patent (322)

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease -1.863 1.9e-03
adult high grade glioma -1.400 5.0e-03
Astrocytoma, Pilocytic -1.600 5.9e-05
chronic lymphosyte leukemia 1.100 3.5e-07
cystic fibrosis -2.707 3.4e-07
ependymoma -1.400 5.9e-05
gastric cancer 1.400 2.2e-03
group 4 medulloblastoma -1.100 4.9e-02
hepatocellular carcinoma 1.500 2.0e-06
Hydrolethalus syndrome -1.138 4.8e-02
intraductal papillary-mucinous neoplasm ... 1.300 1.9e-02
medulloblastoma, large-cell -1.900 4.5e-03
ovarian cancer -1.700 4.0e-08
pancreatic cancer 1.200 3.7e-03
pancreatic carcinoma 1.200 3.7e-03
pancreatic ductal adenocarcinoma liver m... 1.792 4.6e-02
Polycystic ovary syndrome -1.070 2.6e-02
tuberculosis and treatment for 6 months -1.400 1.6e-03
ulcerative colitis -1.400 2.6e-06
X-linked cerebral adrenoleukodystrophy 1.200 4.0e-02

Gene RIF (8)

AA Sequence

MHQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRLPPRPENCRLE      1 - 70
DEGVNSSPYSKPTIAVKPTMMSSEASDVWTEANLSAEVSQVIWRRAPGKLPLPKQEDAPVVYLGSFRGVQ     71 - 140
KPAGPSTSPDGNSRCPPAYTMVGLHNLEPRGERNIAFHPVSFPEEKAVHKEKPSFPYQDRPSTQESFRQK    141 - 210
LAAFAGTTSGCHQGPGPLRESLPSEDDSDQRCSPSGDSEGGEYCSILDCCPGSPVAKAASQTAGSRGRHG    211 - 280
GRDCSPTCWEQGKCSGPAEQEKRGPSFPKECCSQGPTAHPSCLGPKKLSLTSEAAISSDGLSCGSGSGSG    281 - 350
SGASSPFVPHLESDYCSLMKEPAPEKQQDPGCPGVTPSRCLGLTGEPQPPAHPREATQPEPIYAESTKRK    351 - 420
KAAPVPSKSQAKIEHAAAAQGQGQVCTGNAWAQKAASGWGRDSPDPTPQVSATITVMAAHPEEDHRTIYL    421 - 490
SSPDSAVGVQWPRGPVSQNSEVGEEETSAGQGLSSRESHAHSASESKPKERPAIPPKLSKSSPVGSPVSP    491 - 560
SAGGPPVSPLADLSDGSSGGSSIGPQPPSQGPADPAPSCRTNGVAISDPSRCPQPAASSASEQRRPRFQA    561 - 630
GTWSRQCRIEEEEEVEQELLSHSWGRETKNGPTDHSNSTTWHRLHPTDGSSGQNSKVGTGMSKSASFAFE    631 - 700
FPKDRSGIETFSPPPPPPKSRHLLKMNKSSSDLEKVSQGSAESLSPSFRGVHVSFTTGSTDSLASDSRTC    701 - 770
SDGGPSSELAHSPTNSGKKLFAPVPFPSGSTEDVSPSGPQQPPPLPQKKIVSRAASSPDGFFWTQGSPKP    771 - 840
GTASPKLNLSHSETNVHDESHFSYSLSPGNRHHPVFSSSDPLEKAFKGSGHWLPAAGLAGNRGGCGSPGL    841 - 910
QCKGAPSASSSQLSVSSQASTGSTQLQLHGLLSNISSKEGTYAKLGGLYTQSLARLVAKCEDLFMGGQKK    911 - 980
ELHFNENNWSLFKLTCNKPCCDSGDAIYYCATCSEDPGSTYAVKICKAPEPKTVSYCSPSVPVHFNIQQD    981 - 1050
CGHFVASVPSSMLSSPDAPKDPVPALPTHPPAQEQDCVVVITREVPHQTASDFVRDSAASHQAEPEAYER   1051 - 1120
RVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLLVHCTLQAGPGPAPAPAPAPAPAAAAPPCSSAAPPAGG   1121 - 1190
TLSPAAGPASPEGPREKQLPRLIISNFLKAKQKPGGTPNLQQKKSQARLAPEIVSASQYRKFDEFQTGIL   1191 - 1260
IYELLHQPNPFEVRAQLRERDYRQEDLPPLPALSLYSPGLQQLAHLLLEADPIKRIRIGEAKRVLQCLLW   1261 - 1330
GPRRELVQQPGTSEEALCGTLHNWIDMKRALMMMKFAEKAVDRRRGVELEDWLCCQYLASAEPGALLQSL   1331 - 1400
KLLQLL                                                                   1401 - 1406
//

Text Mined References (18)

PMID Year Title