Property Summary

NCBI Gene PubMed Count 191
PubMed Score 469.93
PubTator Score 290.80

Knowledge Summary

Patent (31,010)

Expression

  Differential Expression (23)

Disease log2 FC p
gastric cancer -1.200 3.9e-02
chronic lymphosyte leukemia -1.800 2.1e-07
malignant mesothelioma -1.300 8.4e-07
acute quadriplegic myopathy -1.107 1.6e-02
Atopic dermatitis 1.200 3.6e-06
adrenocortical carcinoma -1.956 6.0e-05
pancreatic ductal adenocarcinoma liver m... -1.145 2.5e-02
intraductal papillary-mucinous neoplasm ... -2.000 9.2e-03
lung cancer -1.300 3.8e-03
colon cancer -1.500 2.1e-03
active Crohn's disease -3.012 4.8e-03
diabetes mellitus -1.200 4.9e-02
interstitial cystitis 1.500 1.6e-02
group 3 medulloblastoma 1.500 8.7e-03
pilocytic astrocytoma 1.600 8.7e-04
Breast cancer -2.500 2.8e-16
lung carcinoma -2.100 1.9e-23
ductal carcinoma in situ 1.100 1.4e-02
acute myeloid leukemia 1.200 4.6e-02
ovarian cancer -3.000 3.2e-08
pituitary cancer 1.400 1.1e-02
Down syndrome 1.900 4.8e-04
psoriasis 1.400 4.6e-133

Gene RIF (158)

PMID Text
26658840 Highly recurrent mutation of GSK1 is associated with nodular lymphocyte predominant Hodgkin lymphoma.
26548813 SGK1 is overexpressed in non-small cell lung cancer.SGK1 positively regulates the growth, migration and metastasis of non-small cell lung cancer.SGK1 activates beta-catenin signaling in NSCLC cells.
26506154 Data suggest that SGK1 expression is down-regulated in prefrontal cortex neurons of post-traumatic stress disorders subjects (male and female; postmortem samples obtained from tissue bank).
26491696 This review focuses on recent advances in understanding of the roles of Akt and SGK1 in the regulation of renal tubular transport.
26429539 SGK1 was up-regulated in CD4 T cells
26359301 data suggest that the induction of SGK1 through treatment with dexamethasone alters MT dynamics to increase Sec5-GEF-H1 interactions, which promote GEF-H1 targeting to adhesion sites.
26277930 After adjustment for multiple testing, single-nucleotide polymorphism rs9376026 was significantly associated with diastolic blood pressure and mean arterial pressure responses to low-sodium intervention
26230157 The results from this study may be of particular importance, because SGK1WT over-expression by activating telomerase and reducing reactive oxygen species levels may delay the processes of endothelial senescence.
26188042 FE65 influences APP degradation via the proteasome, and phosphorylation of FE65 Ser(610) by SGK1 regulates binding of FE65 to APP, APP turnover and processing.
26038830 mRNA levels of ARC and SGK1 did not differ significantly between the schizophrenia or control samples.
26034353 SGK1 inhibits intestinal epithelial cell apoptosis and promotes proliferation via the MEK/ERK/p53 pathway in colitis.
25993992 These findings have identified an anti-inflammatory function of SGK1, elucidated the underlying intracellular mechanisms
25825522 SGK1 overexpression was found to decrease reactive oxygen species generation.
25705664 we discuss the expression of DISC1, DBZ, and SGK1 , their roles in the regulation of oligodendrocyte function, possible interactions of DISC1 and DBZ in relation to SZ, and the activation of the SGK1 signaling cascade in relation to MDD.
25667458 PIN1-mediated SGK1 ubiquitination is a major regulator of tamoxifen-resistant breast cancer cell growth and survival
25614279 SGK1 plays a pivotal role in vascular inflammation during atherogenesis. SGK1 participates in the regulation of monocyte/macrophage migration and MMP-9 transcription via regulation of nuclear factor-kappaB.
25422956 MDD patients with low expression of SGK1 have significantly smaller CA2/3 and CA4/DG volumes compared to patients with high expression of SGK1 mRNA and to healthy controls with low/high expression of SGK1, respectively.
25384981 C4-CER can replace the PI3K/mTORC2 pathway to directly induce SGK1 to autophosphorylate at Ser422, an initial step leading to activation of PDK1 and of SGK1 by PDK1.
25152363 Inhibition of SGK1 activity as a novel therapeutic approach for the treatment of occlusive vascular diseases.
24961472 Increased SGK-1 expression reduces oxidative stress and improves cell survival in endothelial cells.
24878720 Significant associations between SGK1 and SBP.
24864229 The role of distinct SGK1/FOXO3A-associated regulation in p53 versus ANXA7 responses were elucidated and proposed that aberrant SGK1 could affect reciprocal SGK1-FOXO3A-Akt regulation.
24811177 SGK1 phosphorylated Shank2E, increasing CFTR abundance.
24685888 Numerical simulations of the model solutions yield a better understanding of the process and indicate the importance of the SGK1 gene in the development of medulloblastoma
24602173 These results suggested that urinary SGK1 should be a good indicator of tubulointerstitial damage in patients of IgA nephropathy.
24586903 SGK1 selectively increases wild type-CFTR in the plasma membrane of human airway epithelia cells by inhibiting its endocytic retrieval from the membrane.
24431232 These data suggest SGK1 plays a key role in regulating neutrophil survival signaling and thus may prove a valuable therapeutic target for the treatment of inflammatory disease.
24214981 PI3K-SGK1 pathway stabilizes Kv7.1 surface expression by inhibiting Nedd4-2-dependent endocytosis and thereby demonstrates that Nedd4-2 is a key regulator of Kv7.1 localization and turnover in epithelial cells.
24043696 Orai1 is expressed in the human endometrium and is up-regulated by SGK1 and TGFbeta1.
24043625 store-operated Ca(2+) entry regulates SGK1 expression in epithelial cells and suggest that SGK1-dependent cytoprotective signaling involves effects on maintaining mitochondrial function.
23933686 Data suggest that overexpression of SGK1 participates in pathophysiology of several disorders, including metabolic syndrome, hypertension, obesity, diabetes, thrombosis, stroke, inflammation, autoimmune disease, fibrosis, and tumor growth. [REVIEW]
23650397 findings identify SGK1 as a mediator for the effects of cortisol on neurogenesis and GR function, with particular relevance to stress and depression.
23589291 SGK1,3 enhances the expression level of mature hERG channels by inhibiting Nedd4-2 as well as by promoting Rab11-mediated hERG recycling.
23581296 Knockdown of SGK1 markedly reduces proliferation of Akt inhibitor-resistant, but not inhibitor-sensitive, cells.
23487453 Authors also demonstrate that SGK1 is required for influenza A virus ribonucleoprotein nuclear export.
23392695 Transgenic mice with increased SGK1.1 activity shows diminished sensitivity to induced seizures.
23363009 Neuronal expression of SGK1 in aged human brain and its nuclear compartmentalization suggest a possible neuroprotective role.
23339546 Identification of polymorphisms rs1057293 and rs1743966 in the SGK 1 gene, and the Arg97Ile mutation, for the first time in patients with transient tachypnea of the newborn.
23108393 Sgk1-dependent regulation of RANBP1 has functional consequences on both mitotic microtubule activity and taxol sensitivity of cancer cells.
23055545 Low SGK1 expression is related to ACTH-independent cortisol secretion in adrenocortical tumors and is a new prognostic factor in adrenocortical carcinoma.
23034940 Renally expressed Sgk1 isoform, Sgk1_i3, stimulates ENaC activity when heterologously expressed in collecting duct cells.
23019294 SGK1 is activated in human heart failure. In hypertensive heart disease, total SGK1 but not phosphorylated SGK1 increased. The opposite occurred in dilated cardiomyopathy.
23012321 SGK1-dependent ion channel regulation may thus become pathophysiologically relevant primarily after excessive (pathological) expression. Therefore, SGK1 may be considered an attractive therapeutic target despite its broad range of functions.
22832853 Glucocorticoid-inducible genes GILZ and SGK-1 might be promising candidate markers for hippocampal volume changes relevant for diseases like MDD.
22809514 activation of platelets with thrombin stimulates the translation of SGK1.
22704443 Cyclic hydrodynamic pressure stimulating the proliferation of human bladder smooth muscle cells cultured in scaffolds. The signal transduction mechanism for this process is involved with the PI3K/SGK1 and not the PI3K/AKT signaling pathway.
22648267 Genotype status at SGK1 variants may identify individuals prone to salt-sensitive hypertension.
22590650 SGK1 is a gamma-secretase regulator presumably effective through phosphorylation and degradation of NCT.
22309306 Data show that SGK1 regulates cell migration via vinculin dephosphorylation, a mechanism that is controlled by membrane androgen receptor function.
22250980 investigation of the role of SGK1 in the control of airway epithelial Na+ absorption (via up-regulation of the epithelial sodium channel [ENaCalpha, ENaCbeta, and ENaCgamma] under the control of glucocorticoid/dexamethasone in these experiments)
22240294 This explorative analysis of SGK1 expression in non-small cell lung cancer (NSCLC) samples highlights the potential role of this factor in NSCLC patients. prognosis
22001908 Data show that deregulated SGK1 activity in cycling endometrium interferes with embryo implantation, leading to infertility, or predisposes to pregnancy complications by rendering the feto-maternal interface vulnerable to oxidative damage.
21900244 Neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2) regulation by 14-3-3 protein binding at canonical serum and glucocorticoid kinase 1 (SGK1) phosphorylation sites.
21784856 the association of sgk1 with the apical cell membrane, where it interacts with ENaC, is a novel means by which sgk1 specifically enhances ENaC activity in aldosterone-stimulated collecting duct cells.
21757730 mSIN1 protein mediates SGK1 protein interaction with mTORC2 protein complex and is required for selective activation of the epithelial sodium channel
21691090 results suggest that testosterone up-regulates SGK-1 in the kidney contributing to sexual dimorphisms in the cell signalling machinery
21563193 SGK1 expression is high in most untreated prostate cancers and declines with androgen deprivation. However, these data suggest that relatively low expression of SGK1 is associated with higher tumor grade and increased cancer recurrence.
21478911 SGK1 is a highly cytokine-responsive gene in myeloma cells promoting their malignant growth
21430556 in 2 populations, observed an association between genetic variants in SGK1 and ischaemic stroke; this could imply that cerebrovascular amiloride-sensitive sodium channel or other SGK1-regulated proteins may be important for development of ischaemic stroke
21355052 PI3K-activating hormones inhibit ROMK by enhancing its endocytosis via a mechanism that involves phosphorylation of WNK1 by Akt1 and SGK1.
21224398 a crucial role for SGK1 induction in B-13 pancreatic cell transdifferentiation to B-13/H hepatocytes
21147854 SGK1 inhibits the Notch1 signaling pathway via phosphorylation of Fbw7.
21079778 Results show that even though partial methylation of the promoter region of SGK1 is present, this does not account for the different expression levels seen between normal and tumour tissue.
20947508 GILZ1 inhibits SGK1 ubiquitinylation and subsequent proteasome-mediated degradation, thereby prolonging its half-life and increasing its steady-state expression.
20933037 SGK1 expression is enhanced in the temporal neocortex of patients with drug-refractory epilepsy.
20884880 Results suggest that SGK-1 is an injury-responsive kinase that could mediate mechanical stretch-induced proliferation of vascular cells in vein graft, leading to neointima formation.
20832730 Rictor forms a complex with Cullin-1 to promote SGK1 ubiquitination and destruction.
20631247 Data support a physiological role for SGK1.1 in the regulation of delta-ENaC through a pathway that differs from the classical one and suggest that the kinase could serve as an integrator of different signaling pathways converging on the channel.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20525693 Data find that expression of the N termini of all four WNKs results in modest to strong activation of SGK1.
20511718 Glucocorticoid inducible kinase isoforms SGK1-3 are novel potent stimulators of Slc6a19 and may thus participate in the regulation of neutral amino acid transport in vivo.
20466724 analysis of phosphorylatable residues that activate Nedd4-2 and may work together with residues targeted by inhibitory kinases (SGK1 and protein kinase A) to govern Nedd4-2 regulation of epithelial ion transport
20438709 This study reveals that mTORC2 is a critical target of PLD-mediated survival signals and identifies SGK1 as a downstream target of mTORC2 for the stabilization of HDM2.
20433920 HIV-1 Tat-peptide(48-60) inhibits AGC-family kinases (PKB, SGK1, S6K1, MSK1), CAMK-family kinases (CAMK1 and MELK) and a STE family kinase (MKK1)
20338997 interacted selectively with rictor but not with raptor
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies serum/glucocorticoid regulated kinase SGK1 is important for HIV-1 replication
20041238 TRPV6-expressing oocytes I(H) was increased by coexpression of (S422D)SGK1.
19961832 EPO protects from renal I/R injury and SGK1 might contribute to the mediation of EPO effects under ischemic conditions.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19756449 Sgk1, a gene regulated by p53 at the transcriptional level,affects cell proliferation and differentiation and that the expression and the half-life of p53 is regulated by Sgk1 through MDM2 that directs p53 to ubiquitylation and proteosomal degradation.
19706464 c-Src inhibits SGK1-mediated phosphorylation hereby restoring the WNK4-mediated inhibition of ROMK channels thus suppressing K secretion.
19619128 Glucocorticoids can activate the alpha-ENaC gene promoter independently of SGK1.
19617352 the SGK1/Nedd4-2 signaling pathway regulates both CFTR and ENaC trafficking in CF epithelial cells
19584721 The outlined recent findings advanced our understanding of the molecular regulation of SGK1 as well as the role of the kinase in renal physiology--review
19461886 SNP rs9493857 lies within a predicted binding site for Oct1, a transcription factor known to cooperate with the GR in the transactivation of target genes.
19447520 SGK1 expression during liver regeneration is a part of a signaling pathway that is necessary for enhancing ERK signaling activation through modulating the MEK/ERK complex formation.
19380724 GILZ1 and SGK1 provide a physical and functional link between the PI3K- and Raf-1-dependent signaling modules
19232516 PIKfyve is a potent stimulator of ClC-2-activity and contributes to SGK1-dependent regulation of ClC-2.
19088452 The present results reveal two novel PEPT2 posttranslational modulators, SGK1 and NHERF2, which might regulate transport of oligopeptides and peptidomimetic drugs.
19088076 SGK1 phosphorylation of IkappaB Kinase alpha and p300 Up-regulates NF-kappaB activity and increases N-Methyl-D-aspartate receptor NR2A and NR2B expression.
19068477 Coexpression with active Akt1 increased the phosphorylation of Ser397 and thereby SGK1 kinase activity. SGK1 activation was further augmented by coexpression with the protein kinase WNK1 (with no lysine kinase 1).
18985156 Study in three independent European populations supports the conclusion that SGK variability affects diabetes risk.
18985156 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18801914 The role of aldosterone in sodium absorption by intestinal cells via multiple changes in cellular processes, including SGK1 NHE3 and sodium pump activity is reported.
18753299 A conserved NH2-terminal variant of Sgk1 shows improved stability, enhanced membrane association, and greater stimulation of epithelial Na+ transport in a heterologous expression system.
18570873 SGK1 is an mTOR-raptor substrate and mTOR may promote G1 progression in part through SGK1 activation and deregulate the cell cycle in cancer.
18487207 SGK1 negatively regulates the pro-apoptotic transcription factor Forkhead box O3a (FoxO3a) via phosphorylation and exclusion from the nucleus.
18456663 Hsp90 activity is essential for regulating the PI3K/SGK-1 pathway.
18319604 In human renal fibroblasts, serum/glucocorticoid regulated kinase1 (SGK1) and connective tissue growth factor (CTGF) protein expression were enhanced by angiotensin II
18239069 Glucocorticoid (GC)-mediated down-regulation of urokinase plasminogen activator expression via the serum and GC regulated kinase-1/forkhead box O3a pathway.
18209482 The observations support the view that SGK-1 may participate in the pathogenesis of metabolic syndrome.
18209482 Observational study of gene-disease association. (HuGE Navigator)
17985234 SGK1 mRNA is rapidly induced by glucocorticoid stimulation in HEK293 cells
17982255 The observations suggest that SGK1 regulates the creatine transporter SLC6A8 at least partially through phosphorylation and activation of PIKfyve.
17982254 The present observations disclose the transcription of three distinct SGK1 splice variants, which are all markedly upregulated in tumor tissue but differentially upregulated following differentiation or hypoxia.
17965184 study reports the 1.9 A crystal structure of the catalytic domain of inactive SGK1 in complex with AMP-PNP
17932503 These data suggest that SGK-1 is an androgen-regulated gene that plays a pivotal role in AR-dependent survival and gene expression.
17640988 That SGK1 targets FOXO1 in differentiating human endometrium, together with its distinct temporal and spatial expression pattern and increased expression in infertile patients, suggest a major role for this kinase in early pregnancy events.
17595519 A kinase-dead SGK mutant (K127N) had a dominant-negative effect on CFTR, reducing CFTR Cl currents by 38%.
17571248 IL-2 induced regulation of Sgk1 and a role of the IL-2 receptor and Sgk1 in the regulation of epithelial tumor cell death and survival.
17570343 The observations disclose that PIKfyve participates in the SGK1-dependent regulation of SLC5A1.
17568772 SGK1 negatively regulates stress-activated signaling through inhibition of SEK1 function
17442044 In conclusion, maximal glutamate transport modulation by SGK1 is accomplished by direct EAAT4 stimulation and to a lesser extent by inhibition of intrinsic Nedd4-2.
17382906 SGK1 promotes glucose transporter membrane abundance via GLUT4 phosphorylation at Ser274. Thus, SGK1 may contribute to the insulin and GLUT4-dependent regulation of cellular glucose uptake.
17360471 an SGK1 site in WNK4 regulates Na+ channel and K+ channel activity
17317952 Our data do not support that SGK1 gene variations are disease-causing factors in genetically unexplained pseudohypoaldosteronism type 1.
17170520 Incubation with glucose, the Ca2+-ionophore ionomycin and the cytokine TGF-beta1 were all found to evoke significant and time-dependent increases in both SGK1 and alphaENaC protein expression.
16971495 Acute effect of glucocorticoids on NHE3 is mediated by a glucocorticoid receptor dependent mechanism that activates SGK1 in a nongenomic manner.
16847254 SGK1 is targeted to the endoplasmic reticulum-associated ubiquitin-conjugation machinery by an amphipathic helix
16817852 constitutive ubiquitin-mediated degradation of SGK-1 is an important mechanism regulating its biological activity
16443776 SGK1 regulates GLUT1 and may contribute to or account for the PI3 kinase-dependent but PKB-independent stimulation of GLUT1 by insulin.
16301825 SGK1 regulates current amplitudes and kinetic properties of KCNQ4 channel activity, an effect sensitive to mutations in the SGK1 consensus sequence of the channel.
16301823 SGK1 is upregulated in diabetic nephropathy and actively participates in the stimulation of matrix protein deposition in this common deleterious complication of diabetic hyperglycemia.
16221215 Observational study of gene-disease association. (HuGE Navigator)
16221215 SGK-1 risk carriers are at increased risk of hypertension and are more sensitive to the blood pressure elevating effects associated with hyperinsulinemia
16125969 key role for sgk1 in the molecular pathway of cell death, in which sgk1 seems to exert a protective role.
16105029 The effects of high glucose on proximal tubular cells proliferation, reduced apoptosis and increased NHE3 mRNA levels are mediated by EGFR-dependent up-regulation of SGK-1
16036218 SGK1 and SGK3 increase SLC6A8 activity by increasing the maximal transport rate of the carrier. Deranged SGK1 and/or SGK3 dependent regulation of SLC6A8 may affect energy storage particularly in skeletal muscle, heart, and neurons
15737648 In conclusion, the kinases SGK1 and SGK3 increase EAAT5 activity by increasing cell surface abundance of the carrier.
15721303 SGK1 activation has a role in oncofetal fibronectin expression
15695387 SGK acts as an oncogene in breast cancer cells through activation of the IKK-NF-kappaB pathway, thereby preventing apoptosis.
15665527 demonstration of the significance of SGK1 and NHERF2 as TRPV5 modulators which are likely to participate in the regulation of calcium homeostasis by 1,25(OH)2D3
15578212 Co-expression of SGK1, but not of SGK2 or SGK3, increased Kv 4.3/KChIP2b channel currents.
15576372 Nedd4-2 phosphorylation induces SGK ubiquitination and degradation
15496163 ClC-Ka/barttin channels are regulated by SGK1 and SGK3, which may thus participate in the regulation of transport in kidney and inner ear.
15461589 results identify NDRG1 and NDRG2 as physiological substrates for SGK1, and demonstrate that phosphorylation of NDRG1 by SGK1 primes it for phosphorylation by GSK3
15342340 Sgk1 may modulate insulin action on the cotranslational glycosylation of glycoproteins
15328345 cAMP regulates ENaC in part by phosphorylation and inhibition of Nedd4-2. Moreover, Nedd4-2 is a central convergence point for kinase regulation of Na(+) transport.
15304560 Observational study of gene-disease association. (HuGE Navigator)
15304560 These findings argue against important role of coding regions of Sgk1 in blood pressure regulation and hypertension and in the hypertension-related progression of renal diseases.
15208094 cAMP-stimulated Na+ transport in H441 distal lung epithelial cells does not affect levels of this enzyme.
15167446 Observational study of gene-disease association. (HuGE Navigator)
15166308 Na+-coupled glucose transporter 1 (SGLT1) was regulated by neuronal cell expressed developmentally downregulated 4-2 (Nedd4-2) and serum- and glucocorticoid-inducible kinase 1 (SGK1)
15044175 SGK1 stimulates the NaPi IIb, at least in part, by phosphorylating and thereby inhibiting Nedd4-2 binding to its target.
14725621 SGK levels are increased in brains of Huntington's disease patients; SGK phosphorylates huntingtin at serine 421, protecting striatal neurons against polyQ-huntingtin-induced toxicity.
14623317 NHERF2, ROMK1, and SGK1 have roles in regulating protein abundance in the plasma membrane and K(+) current
12923071 up-regulation of SGK1 enhances cell surface epithelial sodium channel expression in collecting duct cells.
12788082 SN1 is a target for the ubiquitin ligase Nedd4-2, which is inactivated by the serum and glucocorticoid inducible kinase SGK1, its isoform SGK3, and protein kinase B.
12684516 SGK-1 phosphorylation of Kir1.1 drives expression on the plasmalemma. The results suggest a possible molecular mechanism for aldosterone-dependent regulation of the secretory potassium channel in the kidney.
12634932 All three members of the SGK family of kinases SGK1-3 and protein kinase B stimulate the slowly activating K(+) channel KCNE1/KCNQ1. The kinases may thus participate in the regulation of KCNE1-dependent transport and excitability.
12590200 The stimulating effect of SGK1 on the Xenopus oocyte Na(+)/K(+)-ATPase is mimicked by the isoforms SGK2 and SGK3.
12444200 NHERF2 and SGK1 interact to enhance ROMK1 activity by enhancing abundance of channel protein in cell membrane, allowing integration of genomic regulation and activation of SGK1 and NHERF2 in control of ROMK1 activity and renal K(+) excretion.
12435876 Glomerulonephritis leads to glomerular and in some cases to epithelial up-regulation of hSGK1 transcription.
12417559 Sgk is a positive regulator of sodium transport.
12397388 Powerful stimulating effect of all three isoforms of SGK on K(+) channels. Those effects may participate in regulation of epithelial transport, cell proliferation, and neuromuscular excitability.
12376324 Glucocorticoidss stimulate sgk1 expression in human epithelial cells via activation of a GRE in the 5'-flanking region of sgk1.
12215463 single nucleotide polymorphisms of SGK linked to variations in blood pressure
12077559 Excessive transcription of the human serum and glucocorticoid dependent kinase hSGK1 in lung fibrosis

AA Sequence

MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMN      1 - 70
ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEE     71 - 140
KHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASAL    141 - 210
GYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDW    211 - 280
WCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIK    281 - 350
SHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG    351 - 420
FSYAPPTDSFL                                                               421 - 431
//

Text Mined References (213)

PMID Year Title
26658840 2016 Highly recurrent mutations of SGK1, DUSP2 and JUNB in nodular lymphocyte predominant Hodgkin lymphoma.
26548813 2016 Serum and glucocorticoid kinase 1 promoted the growth and migration of non-small cell lung cancer cells.
26506154 2015 Decreased SGK1 Expression and Function Contributes to Behavioral Deficits Induced by Traumatic Stress.
26491696 2015 Roles of Akt and SGK1 in the Regulation of Renal Tubular Transport.
26429539 2015 [Up-regulation of serum- and glucocorticoid-inducible kinase 1 (SGK1) of CD4? T cells is positively related to RORC and IL-17A in patients with Kawasaki disease].
26359301 2015 Dexamethasone-induced cellular tension requires a SGK1-stimulated Sec5-GEF-H1 interaction.
26277930 2015 Common Variants in Serum/Glucocorticoid Regulated Kinase 1 (SGK1) and Blood Pressure Responses to Dietary Sodium or Potassium Interventions: A family-Based Association Study.
26230157 2016 Serum- and Glucocorticoid-Inducible Kinase 1 Delay the Onset of Endothelial Senescence by Directly Interacting with Human Telomerase Reverse Transcriptase.
26188042 2015 Phosphorylation of FE65 Ser610 by serum- and glucocorticoid-induced kinase 1 modulates Alzheimer's disease amyloid precursor protein processing.
26038830 2015 Altered Markers of Cortical ?-Aminobutyric Acid Neuronal Activity in Schizophrenia: Role of the NARP Gene.
26034353 2015 SGK1 inhibits cellular apoptosis and promotes proliferation via the MEK/ERK/p53 pathway in colitis.
25993992 2015 Inhibition of serum- and glucocorticoid-inducible kinase 1 enhances TLR-mediated inflammation and promotes endotoxin-driven organ failure.
25825522 2015 Serum- and Glucocorticoid-Inducible Kinase 1 Confers Protection in Cell-Based and in In Vivo Neurotoxin Models via the c-Jun N-Terminal Kinase Signaling Pathway.
25705664 2015 Disturbance of oligodendrocyte function plays a key role in the pathogenesis of schizophrenia and major depressive disorder.
25667458 2015 Prolyl isomerase PIN1 negatively regulates SGK1 stability to mediate tamoxifen resistance in breast cancer cells.
25614279 2015 Pivotal role of serum- and glucocorticoid-inducible kinase 1 in vascular inflammation and atherogenesis.
25422956 2014 Expression of glucocorticoid inducible genes is associated with reductions in cornu ammonis and dentate gyrus volumes in patients with major depressive disorder.
25384981 2014 Activation of 3-phosphoinositide-dependent kinase 1 (PDK1) and serum- and glucocorticoid-induced protein kinase 1 (SGK1) by short-chain sphingolipid C4-ceramide rescues the trafficking defect of ?F508-cystic fibrosis transmembrane conductance regulator (?F508-CFTR).
25152363 2014 Serum and glucocorticoid-regulated kinase 1 promotes vascular smooth muscle cell proliferation via regulation of ?-catenin dynamics.
24961472 2015 Serum glucocorticoid inducible kinase (SGK)-1 protects endothelial cells against oxidative stress and apoptosis induced by hyperglycaemia.
24878720 2014 A gene-based analysis of variants in the serum/glucocorticoid regulated kinase (SGK) genes with blood pressure responses to sodium intake: the GenSalt Study.
24864229 2014 Diverse effects of ANXA7 and p53 on LNCaP prostate cancer cells are associated with regulation of SGK1 transcription and phosphorylation of the SGK1 target FOXO3A.
24811177 2014 Serum- and glucocorticoid-induced protein kinase 1 (SGK1) increases the cystic fibrosis transmembrane conductance regulator (CFTR) in airway epithelial cells by phosphorylating Shank2E protein.
24685888 2014 Revealing the role of SGK1 in the dynamics of medulloblastoma using a mathematical model.
24602173 2014 Urinary serum- and glucocorticoid-inducible kinase SGK1 reflects renal injury in patients with immunoglobulin A nephropathy.
24586903 2014 Serum and glucocorticoid-inducible kinase1 increases plasma membrane wt-CFTR in human airway epithelial cells by inhibiting its endocytic retrieval.
24431232 2014 Serum and glucocorticoid-regulated kinase 1 regulates neutrophil clearance during inflammation resolution.
24214981 2013 A phosphoinositide 3-kinase (PI3K)-serum- and glucocorticoid-inducible kinase 1 (SGK1) pathway promotes Kv7.1 channel surface expression by inhibiting Nedd4-2 protein.
24043696 2014 TGF?1 and SGK1-sensitive store-operated Ca2+ entry and Orai1 expression in endometrial Ishikawa cells.
24043625 2013 Serum- and glucocorticoid-induced protein kinase 1 (SGK1) is regulated by store-operated Ca2+ entry and mediates cytoprotection against necrotic cell death.
23933686 Serum and glucocorticoid inducible kinase, metabolic syndrome, inflammation, and tumor growth.
23650397 2013 Role for the kinase SGK1 in stress, depression, and glucocorticoid effects on hippocampal neurogenesis.
23589291 2013 The serum- and glucocorticoid-inducible kinases SGK1 and SGK3 regulate hERG channel expression via ubiquitin ligase Nedd4-2 and GTPase Rab11.
23581296 2013 Elevated SGK1 predicts resistance of breast cancer cells to Akt inhibitors.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23487453 2013 Serum- and glucocorticoid-regulated kinase 1 is required for nuclear export of the ribonucleoprotein of influenza A virus.
23392695 2013 The neuronal serum- and glucocorticoid-regulated kinase 1.1 reduces neuronal excitability and protects against seizures through upregulation of the M-current.
23363009 2013 The cell survival kinase SGK1 and its targets FOXO3a and NDRG1 in aged human brain.
23339546 2013 Investigation of the serum glucocorticoid kinase 1 gene in patients with transient tachypnea of the newborn.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23108393 2013 Sgk1 enhances RANBP1 transcript levels and decreases taxol sensitivity in RKO colon carcinoma cells.
23055545 2012 Low SGK1 expression in human adrenocortical tumors is associated with ACTH-independent glucocorticoid secretion and poor prognosis.
23034940 2012 A regulated NH2-terminal Sgk1 variant with enhanced function is expressed in the collecting duct.
23019294 2012 Pathological role of serum- and glucocorticoid-regulated kinase 1 in adverse ventricular remodeling.
23012321 2013 Regulation of ion channels by the serum- and glucocorticoid-inducible kinase SGK1.
22832853 2012 Reduced expression of glucocorticoid-inducible genes GILZ and SGK-1: high IL-6 levels are associated with reduced hippocampal volumes in major depressive disorder.
22809514 2012 Translational regulation of the serum- and glucocorticoid-inducible kinase-1 (SGK1) in platelets.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22704443 2012 Simulated bladder pressure stimulates human bladder smooth muscle cell proliferation via the PI3K/SGK1 signaling pathway.
22648267 2013 Polymorphisms in the serum- and glucocorticoid-inducible kinase 1 gene are associated with blood pressure and renin response to dietary salt intake.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22590650 2012 Phosphorylation of nicastrin by SGK1 leads to its degradation through lysosomal and proteasomal pathways.
22309306 2012 Serum- and glucocorticoid-dependent kinase-1-induced cell migration is dependent on vinculin and regulated by the membrane androgen receptor.
22250980 2012 Epithelial Na? channel activity in human airway epithelial cells: the role of serum and glucocorticoid-inducible kinase 1.
22240294 2012 Determination of SGK1 mRNA in non-small cell lung cancer samples underlines high expression in squamous cell carcinomas.
22001908 2011 Deregulation of the serum- and glucocorticoid-inducible kinase SGK1 in the endometrium causes reproductive failure.
21900244 2011 Neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2) regulation by 14-3-3 protein binding at canonical serum and glucocorticoid kinase 1 (SGK1) phosphorylation sites.
21865597 2011 Serum- and glucocorticoid-induced kinase 3 in recycling endosomes mediates acute activation of Na+/H+ exchanger NHE3 by glucocorticoids.
21784856 2011 Epithelial sodium channel regulation by cell surface-associated serum- and glucocorticoid-regulated kinase 1.
21757730 2011 mSIN1 protein mediates SGK1 protein interaction with mTORC2 protein complex and is required for selective activation of the epithelial sodium channel.
21691090 2011 Gender differences in serum and glucocorticoid regulated kinase-1 (SGK-1) expression during renal ischemia/reperfusion injury.
21563193 2012 Serum/glucocorticoid-regulated kinase 1 expression in primary human prostate cancers.
21478911 2011 Serum/glucocorticoid-regulated kinase 1 (SGK1) is a prominent target gene of the transcriptional response to cytokines in multiple myeloma and supports the growth of myeloma cells.
21430556 2011 Genetic variants in serum and glucocortocoid regulated kinase 1, a regulator of the epithelial sodium channel, are associated with ischaemic stroke.
21355052 2011 Activation of PI3-kinase stimulates endocytosis of ROMK via Akt1/SGK1-dependent phosphorylation of WNK1.
21224398 2011 Serine/threonine protein kinase SGK1 in glucocorticoid-dependent transdifferentiation of pancreatic acinar cells to hepatocytes.
21147854 2011 Serum- and glucocorticoid-inducible kinase 1 (SGK1) controls Notch1 signaling by downregulation of protein stability through Fbw7 ubiquitin ligase.
21079778 2010 Down-regulation of serum/glucocorticoid regulated kinase 1 in colorectal tumours is largely independent of promoter hypermethylation.
20947508 2010 Glucocorticoid-induced Leucine zipper 1 stimulates the epithelial sodium channel by regulating serum- and glucocorticoid-induced kinase 1 stability and subcellular localization.
20933037 2010 Up-regulation of serum- and glucocorticoid-induced protein kinase 1 in the brain tissue of human and experimental epilepsy.
20919962 2010 Second AKT: the rise of SGK in cancer signalling.
20884880 2010 The mechanical stress-activated serum-, glucocorticoid-regulated kinase 1 contributes to neointima formation in vein grafts.
20832730 2010 Rictor forms a complex with Cullin-1 to promote SGK1 ubiquitination and destruction.
20730100 2010 Interaction of serum- and glucocorticoid regulated kinase 1 (SGK1) with the WW-domains of Nedd4-2 is required for epithelial sodium channel regulation.
20631247 2010 The neuronal-specific SGK1.1 kinase regulates {delta}-epithelial Na+ channel independently of PY motifs and couples it to phospholipase C signaling.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20530112 2010 Significance of SGK1 in the regulation of neuronal function.
20525693 2010 Serum and glucocorticoid-induced kinase (SGK) 1 and the epithelial sodium channel are regulated by multiple with no lysine (WNK) family members.
20511718 2010 The serum and glucocorticoid inducible kinases SGK1-3 stimulate the neutral amino acid transporter SLC6A19.
20466724 2010 Phosphopeptide screen uncovers novel phosphorylation sites of Nedd4-2 that potentiate its inhibition of the epithelial Na+ channel.
20438709 2010 Phospholipase D stabilizes HDM2 through an mTORC2/SGK1 pathway.
20338997 2010 mTOR complex-2 activates ENaC by phosphorylating SGK1.
20237237 2010 COMMD1 downregulates the epithelial sodium channel through Nedd4-2.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20041238 2010 Regulation of the Ca(2+) channel TRPV6 by the kinases SGK1, PKB/Akt, and PIKfyve.
19961832 2010 Role of serum and glucocorticoid-regulated kinase-1 in the protective effects of erythropoietin during renal ischemia/reperfusion injury.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19756449 2009 Sgk1 activates MDM2-dependent p53 degradation and affects cell proliferation, survival, and differentiation.
19706464 2009 Src family protein tyrosine kinase (PTK) modulates the effect of SGK1 and WNK4 on ROMK channels.
19619128 2009 Glucocorticoids can activate the alpha-ENaC gene promoter independently of SGK1.
19617352 2009 Rescue of DeltaF508-CFTR by the SGK1/Nedd4-2 signaling pathway.
19584721 2009 The physiological impact of the serum and glucocorticoid-inducible kinase SGK1.
19461886 2009 Adaptive variation regulates the expression of the human SGK1 gene in response to stress.
19447520 2009 Protein kinase SGK1 enhances MEK/ERK complex formation through the phosphorylation of ERK2: implication for the positive regulatory role of SGK1 on the ERK function during liver regeneration.
19380724 2009 Epithelial sodium channel regulated by differential composition of a signaling complex.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19232516 2009 PIKfyve-dependent regulation of the Cl- channel ClC-2.
19088452 2008 The peptide transporter PEPT2 is targeted by the protein kinase SGK1 and the scaffold protein NHERF2.
19088076 2009 SGK1 phosphorylation of IkappaB Kinase alpha and p300 Up-regulates NF-kappaB activity and increases N-Methyl-D-aspartate receptor NR2A and NR2B expression.
19068477 2009 Regulation of a third conserved phosphorylation site in SGK1.
18985156 2008 Variance of the SGK1 gene is associated with insulin secretion in different European populations: results from the TUEF, EUGENE2, and METSIM studies.
18925875 2008 mTOR complex 2 (mTORC2) controls hydrophobic motif phosphorylation and activation of serum- and glucocorticoid-induced protein kinase 1 (SGK1).
18801914 2008 Aldosterone regulation of intestinal Na absorption involves SGK-mediated changes in NHE3 and Na+ pump activity.
18753299 2008 An evolutionarily conserved N-terminal Sgk1 variant with enhanced stability and improved function.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18570873 2008 mTOR-raptor binds and activates SGK1 to regulate p27 phosphorylation.
18487207 2008 Wnt signaling inhibits Forkhead box O3a-induced transcription and apoptosis through up-regulation of serum- and glucocorticoid-inducible kinase 1.
18456663 2008 Hsp90 regulates the phosphorylation and activity of serum- and glucocorticoid-regulated kinase-1.
18334630 2008 A brain-specific SGK1 splice isoform regulates expression of ASIC1 in neurons.
18319604 2008 SGK1-dependent upregulation of connective tissue growth factor by angiotensin II.
18304449 2008 Regulation Fe65 localization to the nucleus by SGK1 phosphorylation of its Ser566 residue.
18239069 2008 Glucocorticoid (GC)-mediated down-regulation of urokinase plasminogen activator expression via the serum and GC regulated kinase-1/forkhead box O3a pathway.
18209482 2008 Association of SGK1 gene polymorphisms with type 2 diabetes.
18005662 2007 Regulation of the epithelial calcium channel TRPV6 by the serum and glucocorticoid-inducible kinase isoforms SGK1 and SGK3.
17985234 2008 Dex-ras1 and serum- and glucocorticoid-inducible protein kinase 1: regulation of expression by dexamethasone in HEK293 cells.
17982255 2007 PIKfyve in the SGK1 mediated regulation of the creatine transporter SLC6A8.
17982254 2007 Differential regulation of serum- and glucocorticoid-inducible kinase 1 (SGK1) splice variants based on alternative initiation of transcription.
17965184 2007 Crystal structure of the kinase domain of serum and glucocorticoid-regulated kinase 1 in complex with AMP PNP.
17932503 2007 Serum/glucocorticoid-induced protein kinase-1 facilitates androgen receptor-dependent cell survival.
17640988 2007 Role and regulation of the serum- and glucocorticoid-regulated kinase 1 in fertile and infertile human endometrium.
17595519 2007 Regulation of human cystic fibrosis transmembrane conductance regulator (CFTR) by serum- and glucocorticoid-inducible kinase (SGK1).
17571248 2007 IL-2 signals through Sgk1 and inhibits proliferation and apoptosis in kidney cancer cells.
17570343 2007 Regulation of the Na(+), glucose cotransporter by PIKfyve and the serum and glucocorticoid inducible kinase SGK1.
17568772 2007 Negative regulation of SEK1 signaling by serum- and glucocorticoid-inducible protein kinase 1.
17442044 2007 EAAT4 phosphorylation at the SGK1 consensus site is required for transport modulation by the kinase.
17382906 2007 Role of SGK1 kinase in regulating glucose transport via glucose transporter GLUT4.
17360471 2007 An SGK1 site in WNK4 regulates Na+ channel and K+ channel activity and has implications for aldosterone signaling and K+ homeostasis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17317952 2007 Exclusion of serum- and glucocorticoid-induced kinase 1 (SGK1) as a candidate gene for genetically heterogeneous renal pseudohypoaldosteronism type I in eight families.
17314099 2007 NM23-H1 tumor suppressor physically interacts with serine-threonine kinase receptor-associated protein, a transforming growth factor-beta (TGF-beta) receptor-interacting protein, and negatively regulates TGF-beta signaling.
17202226 2007 Subcellular location of serum- and glucocorticoid-induced kinase-1 in renal and mammary epithelial cells.
17170520 2006 High glucose up-regulates ENaC and SGK1 expression in HCD-cells.
16982696 2006 Serum- and glucocorticoid-inducible kinase 1 (SGK1) increases neurite formation through microtubule depolymerization by SGK1 and by SGK1 phosphorylation of tau.
16971495 2007 Acute activation of NHE3 by dexamethasone correlates with activation of SGK1 and requires a functional glucocorticoid receptor.
16847254 2006 An amphipathic helix targets serum and glucocorticoid-induced kinase 1 to the endoplasmic reticulum-associated ubiquitin-conjugation machinery.
16817852 2006 A novel N-terminal hydrophobic motif mediates constitutive degradation of serum- and glucocorticoid-induced kinase-1 by the ubiquitin-proteasome pathway.
16543730 2006 DOCA-induced phosphorylation of glycogen synthase kinase 3beta.
16460280 2006 Sgk kinases and their role in epithelial transport.
16443776 2006 SGK1 kinase upregulates GLUT1 activity and plasma membrane expression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16301825 2005 Regulation of KCNQ4 potassium channel prepulse dependence and current amplitude by SGK1 in Xenopus oocytes.
16301823 2005 SGK1-mediated fibronectin formation in diabetic nephropathy.
16221215 2005 Genetic variance of SGK-1 is associated with blood pressure, blood pressure change over time and strength of the insulin-diastolic blood pressure relationship.
16125969 2005 Sgk1, a cell survival response in neurodegenerative diseases.
16105029 2005 High glucose transactivates the EGF receptor and up-regulates serum glucocorticoid kinase in the proximal tubule.
16036218 2005 Stimulation of the creatine transporter SLC6A8 by the protein kinases SGK1 and SGK3.
15888551 2005 Activation of NHE3 by dexamethasone requires phosphorylation of NHE3 at Ser663 by SGK1.
15845389 2005 The serine/threonine kinases SGK1, 3 and PKB stimulate the amino acid transporter ASCT2.
15737648 2005 Regulation of the excitatory amino acid transporter EAAT5 by the serum and glucocorticoid dependent kinases SGK1 and SGK3.
15733869 2005 Serum/glucocorticoid-inducible kinase can phosphorylate the cyclic AMP response element binding protein, CREB.
15721303 2005 Glucose-induced serum- and glucocorticoid-regulated kinase activation in oncofetal fibronectin expression.
15695387 2005 Antiapoptotic effect of serum and glucocorticoid-inducible protein kinase is mediated by novel mechanism activating I{kappa}B kinase.
15665527 2005 Requirement of PDZ domains for the stimulation of the epithelial Ca2+ channel TRPV5 by the NHE regulating factor NHERF2 and the serum and glucocorticoid inducible kinase SGK1.
15578212 2005 Regulation of cardiac shal-related potassium channel Kv 4.3 by serum- and glucocorticoid-inducible kinase isoforms in Xenopus oocytes.
15576372 2005 Nedd4-2 phosphorylation induces serum and glucocorticoid-regulated kinase (SGK) ubiquitination and degradation.
15496163 2004 Regulation of CLC-Ka/barttin by the ubiquitin ligase Nedd4-2 and the serum- and glucocorticoid-dependent kinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461589 2004 Exploitation of KESTREL to identify NDRG family members as physiological substrates for SGK1 and GSK3.
15342340 2005 Serum and glucocorticoid-regulated kinase Sgk1 inhibits insulin-dependent activation of phosphomannomutase 2 in transfected COS-7 cells.
15328345 2004 cAMP and serum and glucocorticoid-inducible kinase (SGK) regulate the epithelial Na(+) channel through convergent phosphorylation of Nedd4-2.
15319523 2004 Regulation of the epithelial Ca2+ channel TRPV5 by the NHE regulating factor NHERF2 and the serum and glucocorticoid inducible kinase isoforms SGK1 and SGK3 expressed in Xenopus oocytes.
15304560 2004 Low prevalence of nonconservative mutations of serum and glucocorticoid-regulated kinase (SGK1) gene in hypertensive and renal patients.
15234985 2004 A novel pathway of epithelial sodium channel activation involves a serum- and glucocorticoid-inducible kinase consensus motif in the C terminus of the channel's alpha-subunit.
15208094 2004 cAMP-stimulated Na+ transport in H441 distal lung epithelial cells: role of PKA, phosphatidylinositol 3-kinase, and sgk1.
15167446 2004 Genetic analysis of 22 candidate genes for hypertension in the Japanese population.
15166308 2004 Regulation of glucose transporter SGLT1 by ubiquitin ligase Nedd4-2 and kinases SGK1, SGK3, and PKB.
15044175 2004 Regulation of intestinal phosphate cotransporter NaPi IIb by ubiquitin ligase Nedd4-2 and by serum- and glucocorticoid-dependent kinase 1.
15040001 2004 Regulation of the voltage gated K+ channel Kv1.3 by the ubiquitin ligase Nedd4-2 and the serum and glucocorticoid inducible kinase SGK1.
14725621 2004 The serum- and glucocorticoid-induced kinase SGK inhibits mutant huntingtin-induced toxicity by phosphorylating serine 421 of huntingtin.
14706641 2004 Stimulation of renal Na+ dicarboxylate cotransporter 1 by Na+/H+ exchanger regulating factor 2, serum and glucocorticoid inducible kinase isoforms, and protein kinase B.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623317 2003 Molecular requirements for the regulation of the renal outer medullary K(+) channel ROMK1 by the serum- and glucocorticoid-inducible kinase SGK1.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12923071 2003 PPARgamma activation enhances cell surface ENaCalpha via up-regulation of SGK1 in human collecting duct cells.
12911626 2003 Regulation of the glutamate transporter EAAT1 by the ubiquitin ligase Nedd4-2 and the serum and glucocorticoid-inducible kinase isoforms SGK1/3 and protein kinase B.
12823993 2003 Expression and distribution of the serum and glucocorticoid regulated kinase and the epithelial sodium channel subunits in the human cornea.
12788082 2003 Properties and regulation of glutamine transporter SN1 by protein kinases SGK and PKB.
12761204 2003 Inhibition of mitogen-activated kinase kinase kinase 3 activity through phosphorylation by the serum- and glucocorticoid-induced kinase 1.
12729930 2003 Characterization of the interactions between Nedd4-2, ENaC, and sgk-1 using surface plasmon resonance.
12684516 2003 Cell surface expression of the ROMK (Kir 1.1) channel is regulated by the aldosterone-induced kinase, SGK-1, and protein kinase A.
12650886 2003 Serum and glucocorticoid inducible kinases in the regulation of the cardiac sodium channel SCN5A.
12649597 2003 Stimulus-dependent regulation of serum and glucocorticoid inducible protein kinase (SGK) transcription, subcellular localization and enzymatic activity.
12634932 2003 Regulation of KCNE1-dependent K(+) current by the serum and glucocorticoid-inducible kinase (SGK) isoforms.
12631736 2003 Importin-alpha mediates the regulated nuclear targeting of serum- and glucocorticoid-inducible protein kinase (Sgk) by recognition of a nuclear localization signal in the kinase central domain.
12628440 2003 Increased intracellular calcium activates serum and glucocorticoid-inducible kinase 1 (SGK1) through a calmodulin-calcium calmodulin dependent kinase kinase pathway in Chinese hamster ovary cells.
12590200 2002 Activation of Na+/K+-ATPase by the serum and glucocorticoid-dependent kinase isoforms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444200 2002 The serum and glucocorticoid-inducible kinase SGK1 and the Na+/H+ exchange regulating factor NHERF2 synergize to stimulate the renal outer medullary K+ channel ROMK1.
12435876 2002 Up-regulation of the human serum and glucocorticoid-dependent kinase 1 in glomerulonephritis.
12417559 2002 Sgk: an old enzyme revisited.
12397388 2002 K+ channel activation by all three isoforms of serum- and glucocorticoid-dependent protein kinase SGK.
12387817 2002 The Na(+)/H(+) exchanger regulatory factor 2 mediates phosphorylation of serum- and glucocorticoid-induced protein kinase 1 by 3-phosphoinositide-dependent protein kinase 1.
12376324 2002 Glucocorticoids stimulate human sgk1 gene expression by activation of a GRE in its 5'-flanking region.
12218062 2002 Ubiquitin modification of serum and glucocorticoid-induced protein kinase-1 (SGK-1).
12215463 2002 Serum- and glucocorticoid-regulated kinase (SGK1) gene and blood pressure.
12077559 2002 Excessive transcription of the human serum and glucocorticoid dependent kinase hSGK1 in lung fibrosis.
12023960 2002 Molecular basis for the substrate specificity of NIMA-related kinase-6 (NEK6). Evidence that NEK6 does not phosphorylate the hydrophobic motif of ribosomal S6 protein kinase and serum- and glucocorticoid-induced protein kinase in vivo.
11751930 2002 Glucocorticoid activation of Na(+)/H(+) exchanger isoform 3 revisited. The roles of SGK1 and NHERF2.
11742982 2001 Phosphorylation of Nedd4-2 by Sgk1 regulates epithelial Na(+) channel cell surface expression.
11707620 2001 Regulation and physiological roles of serum- and glucocorticoid-induced protein kinase isoforms.
11696533 2002 Serum and glucocorticoid-regulated kinase modulates Nedd4-2-mediated inhibition of the epithelial Na+ channel.
11410590 2001 Serum- and glucocorticoid-inducible kinase SGK phosphorylates and negatively regulates B-Raf.
11254654 2001 BMK1 mediates growth factor-induced cell proliferation through direct cellular activation of serum and glucocorticoid-inducible kinase.
11154281 2001 Protein kinase SGK mediates survival signals by phosphorylating the forkhead transcription factor FKHRL1 (FOXO3a).
11096081 2001 Activation of serum- and glucocorticoid-induced protein kinase (Sgk) by cyclic AMP and insulin.
10884438 2000 Deranged transcriptional regulation of cell-volume-sensitive kinase hSGK in diabetic nephropathy.
10869359 2000 Negative regulation of the serine/threonine kinase B-Raf by Akt.
10548550 1999 Characterization of the structure and regulation of two novel isoforms of serum- and glucocorticoid-induced protein kinase.
10357815 1999 Serum and glucocorticoid-inducible kinase (SGK) is a target of the PI 3-kinase-stimulated signaling pathway.
10191262 1999 Activation of serum- and glucocorticoid-regulated protein kinase by agonists that activate phosphatidylinositide 3-kinase is mediated by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2.
9722955 1998 Genomic organization and chromosomal localization of the human SGK protein kinase gene.
9114008 1997 Cloning and characterization of a putative human serine/threonine protein kinase transcriptionally modified during anisotonic and isotonic alterations of cell volume.