Property Summary

Ligand Count 50
NCBI Gene PubMed Count 211
PubMed Score 543.65
PubTator Score 290.80

Knowledge Summary

Patent (31,010)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Immune system cancer 140 0.0 0.7
Lymphoid leukemia 160 0.0 0.7
Disease Target Count Z-score Confidence
Dental caries 164 0.0 1.2
Gout 104 0.0 3.0
Melanoma 711 0.0 2.7
Disease Target Count Z-score Confidence
Hypertension 396 4.113 2.1
Kidney disease 430 3.883 1.9
Cancer 2499 3.526 1.8

Expression

  Differential Expression (23)

Disease log2 FC p
diabetes mellitus -1.200 4.9e-02
active Crohn's disease -3.012 4.8e-03
acute myeloid leukemia 1.200 4.6e-02
acute quadriplegic myopathy -1.107 1.6e-02
adrenocortical carcinoma -1.956 6.0e-05
Astrocytoma, Pilocytic 1.600 9.2e-04
Atopic dermatitis 1.200 3.6e-06
Breast cancer -2.500 2.8e-16
Chronic Lymphocytic Leukemia -1.446 6.5e-04
colon cancer -1.500 2.1e-03
Down syndrome 1.900 4.8e-04
ductal carcinoma in situ 1.100 1.4e-02
gastric cancer -1.200 3.9e-02
group 3 medulloblastoma 1.500 8.7e-03
interstitial cystitis 1.300 4.8e-02
intraductal papillary-mucinous neoplasm ... -2.000 9.2e-03
lung cancer -1.300 3.8e-03
lung carcinoma -2.100 1.9e-23
malignant mesothelioma -1.300 8.4e-07
ovarian cancer -3.000 3.2e-08
pancreatic ductal adenocarcinoma liver m... -1.145 2.5e-02
pituitary cancer 1.400 1.1e-02
psoriasis 1.400 4.6e-133

Protein-protein Interaction (7)

Gene RIF (177)

AA Sequence

MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMN      1 - 70
ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEE     71 - 140
KHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASAL    141 - 210
GYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDW    211 - 280
WCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIK    281 - 350
SHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG    351 - 420
FSYAPPTDSFL                                                               421 - 431
//

Text Mined References (232)

PMID Year Title