Property Summary

NCBI Gene PubMed Count 21
PubMed Score 5.19
PubTator Score 6.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -1.700 3.0e-22
posterior fossa group A ependymoma -4.200 3.2e-21
oligodendroglioma -2.000 8.0e-03
glioblastoma -3.500 6.4e-06
group 3 medulloblastoma -2.800 3.3e-04
atypical teratoid / rhabdoid tumor -3.900 1.1e-09
medulloblastoma, large-cell -3.600 6.5e-06
primitive neuroectodermal tumor -2.800 1.7e-04
interstitial cystitis 2.500 2.4e-04
pediatric high grade glioma -2.900 1.4e-06
pilocytic astrocytoma -1.400 9.4e-05
subependymal giant cell astrocytoma -2.123 4.4e-02
non-small cell lung carcinoma -1.100 1.8e-22
Alzheimer's disease -1.200 1.9e-02
Pick disease -2.000 5.5e-05
pituitary cancer 1.900 2.9e-06

Gene RIF (8)

PMID Text
21407171 Our results show association between genetic variants in SGIP1 and fat mass. We provide evidence that variation in SGIP1 is a potentially important determinant of obesity-related traits in humans
21317682 The earlier implicated single nucleotide polymorphisms located in SGIP1 gene showed no association with alcohol dependence or theta electroencephalogram power.
20946875 SGIP1 and the signaling adaptor Reps1 interact with ITSN1 in vivo.
20421487 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
17626015 SGIP1alpha plays an essential role in clathrin-mediated endocytosis by interacting with phospholipids and Eps15.

AA Sequence

MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIQPSPHEPPYNSKAECAREGGKKVSKKSNGAPNGFYAE      1 - 70
IDWERYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPLQSKDILKNAATVDELK     71 - 140
ASIGNIALSPSPVRKSPRRSPGAIKRNLSSEEVARPRRSTPTPELISKKPPDDTTALAPLFGPPLESAFD    141 - 210
EQKTEVLLDQPEIWGSGQPINPSMESPKLTRPFPTGTPPPLPPKNVPATPPRTGSPLTIGPGNDQSATEV    211 - 280
KIEKLPSINDLDSIFGPVLSPKSVAVNAEEKWVHFSDTSPEHVTPELTPREKVVSPPATPDNPADSPAPG    281 - 350
PLGPPGPTGPPGPPGPPRNVLSPLNLEEVQKKVAEQTFIKDDYLETISSPKDFGLGQRATPPPPPPPTYR    351 - 420
TVVSSPGPGSGPGPGTTSGASSPARPATPLVPCRSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIH    421 - 490
SSSPPPIAPLARAESTSSISSTNSLSAATTPTVENEQPSLVWFDRGKFYLTFEGSSRGPSPLTMGAQDTL    491 - 560
PVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVINFSRLEHVLPNPQL    561 - 630
LCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVSAQGIQSTPLNLAVNWRCEPSS    631 - 700
TDLRIDYKYNTDAMTTAVALNNVQFLVPIDGGVTKLQAVLPPAVWNAEQQRILWKIPDISQKSENGGVGS    701 - 770
LLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYLADN                771 - 828
//

Text Mined References (22)

PMID Year Title
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23307926 2013 A genome-wide association study of early menopause and the combined impact of identified variants.
21407171 2012 Genetic variation in SH3-domain GRB2-like (endophilin)-interacting protein 1 has a major impact on fat mass.
21317682 2011 Nonreplication of an association of SGIP1 SNPs with alcohol dependence and resting theta EEG power.
20946875 2010 Intersectin 1 forms complexes with SGIP1 and Reps1 in clathrin-coated pits.
20421487 2010 Genome-wide association identifies candidate genes that influence the human electroencephalogram.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17626015 2007 SGIP1alpha is an endocytic protein that directly interacts with phospholipids and Eps15.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15919751 2005 Src homology 3-domain growth factor receptor-bound 2-like (endophilin) interacting protein 1, a novel neuronal protein that regulates energy balance.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.