Property Summary

NCBI Gene PubMed Count 16
PubMed Score 590.13
PubTator Score 6.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 9.5e-07
malignant mesothelioma 3232 4.8e-06
group 3 medulloblastoma 4104 4.1e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.148 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 4.1e-03
malignant mesothelioma 1.100 4.8e-06
osteosarcoma -1.644 9.5e-07

 GO Function (1)

Gene RIF (1)

AA Sequence

MALVSADSRIAELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLRGLYTTAKADA      1 - 70
EAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLMTLLQQSAMTLPLWIGKPGDK     71 - 140
PPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRV    141 - 210
IPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVA    211 - 280
QRYVVACKEPKKK                                                             281 - 293
//

Text Mined References (20)

PMID Year Title