Property Summary

NCBI Gene PubMed Count 41
PubMed Score 333.00
PubTator Score 208.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Limb-girdle muscular dystrophy, type 2C 1 0.0 0.0
Osteoarthritis 179 0.0 0.0
Disease Target Count P-value
psoriasis 6514 1.3e-67
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Kidney cancer 2548 0.0 0.5
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 268 0.0 3.0
substance-related disorder 156 0.0 0.9
Disease Target Count Z-score Confidence
limb-girdle muscular dystrophy 37 0.0 4.0
Disease Target Count Z-score Confidence
Transient myeloproliferative syndrome 7 4.099 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 1.3e-67

Gene RIF (17)

AA Sequence

MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGH      1 - 70
LCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQF     71 - 140
QINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVH    141 - 210
IQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVS    211 - 280
TTCQEHNHICL                                                               281 - 291
//

Text Mined References (41)

PMID Year Title