Property Summary

NCBI Gene PubMed Count 79
PubMed Score 158.33
PubTator Score 154.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Myoclonic dystonia 5 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Dystonia 164 7.167 3.6
Disease Target Count
Dystonia 11, Myoclonic 3

Expression

  Differential Expression (19)

Disease log2 FC p
Atopic dermatitis -1.300 4.3e-04
autosomal dominant Emery-Dreifuss muscul... 1.041 4.6e-03
Breast cancer 3.000 3.2e-02
breast carcinoma -1.100 8.6e-17
colon cancer -2.800 1.2e-02
dermatomyositis 1.100 1.5e-02
Duchenne muscular dystrophy 1.088 4.4e-07
ductal carcinoma in situ -1.200 5.3e-03
interstitial cystitis -1.100 4.8e-03
intraductal papillary-mucinous adenoma (... -3.800 2.2e-05
intraductal papillary-mucinous carcinoma... -3.300 1.2e-03
intraductal papillary-mucinous neoplasm ... -3.400 2.2e-03
invasive ductal carcinoma -1.157 5.2e-03
lung adenocarcinoma -1.300 1.3e-09
non-small cell lung cancer -1.081 1.0e-06
osteosarcoma 1.492 8.7e-03
ovarian cancer -2.900 1.4e-05
psoriasis -1.400 1.1e-05
ulcerative colitis 1.300 6.9e-03

 GWAS Trait (1)

Gene RIF (63)

AA Sequence

MQLPRWWELGDPCAWTGQGRGTRRMSPATTGTFLLTVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGE      1 - 70
FPPYPKPGEISNDPITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTAENVGKPTIIEITAYNRRTFE     71 - 140
TARHNLIINIMSAEDFPLPYQAEFFIKNMNVEEMLASEVLGDFLGAVKNVWQPERLNAINITSALDRGGR    141 - 210
VPLPINDLKEGVYVMVGADVPFSSCLREVENPQNQLRCSQEMEPVITCDKKFRTQFYIDWCKISLVDKTK    211 - 280
QVSTYQEVIRGEGILPDGGEYKPPSDSLKSRDYYTDFLITLAVPSAVALVLFLILAYIMCCRREGVEKRN    281 - 350
MQTPDIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNL    351 - 420
PHQTQIPQQQTTGKWYP                                                         421 - 437
//

Text Mined References (85)

PMID Year Title