Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.38
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis 1.923 4.6e-02
adrenocortical carcinoma 1.069 1.2e-02
atypical teratoid / rhabdoid tumor -1.300 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-02
osteosarcoma -1.356 6.9e-03
ovarian cancer 1.500 4.4e-06
pancreatic cancer 1.200 4.0e-03
pancreatic ductal adenocarcinoma liver m... 1.233 3.4e-02
psoriasis -1.100 1.3e-08
sonic hedgehog group medulloblastoma -1.700 1.0e-05
urothelial carcinoma 1.100 4.3e-02

Gene RIF (2)

AA Sequence

MGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRA      1 - 70
KYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTP     71 - 140
ITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPVADEA    141 - 210
GQRLGYSVTAAKQGIFQVVISRICMAIPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATP    211 - 280
LCCALFPQKSSIHISNLEPELRAQIHEQNPSVEVVYYNKGL                                 281 - 321
//

Text Mined References (11)

PMID Year Title