Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.38
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
urothelial carcinoma 1.100 4.3e-02
psoriasis -2.900 6.0e-06
osteosarcoma -1.356 6.9e-03
atypical teratoid/rhabdoid tumor -1.600 2.3e-04
adrenocortical carcinoma 1.069 1.2e-02
primary pancreatic ductal adenocarcinoma 1.247 4.9e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-02
active ulcerative colitis 1.923 4.6e-02
sonic hedgehog group medulloblastoma -1.700 1.0e-05
ovarian cancer 1.500 4.4e-06
pancreatic cancer 1.200 4.0e-03

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of sideroflexin 3 (SFXN3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQ      1 - 70
LWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRS     71 - 140
GDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPV    141 - 210
ADEAGQRLGYSVTAAKQGIFQVVISRICMAIPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLV    211 - 280
FATPLCCALFPQKSSIHISNLEPELRAQIHEQNPSVEVVYYNKGL                             281 - 325
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.