Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.73
PubTator Score 12.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma 1.400 5.2e-03
ependymoma -1.500 3.5e-07
oligodendroglioma 1.600 6.5e-03
psoriasis -2.300 1.4e-04
osteosarcoma -2.564 5.2e-07
atypical teratoid / rhabdoid tumor -1.400 3.3e-05
glioblastoma -1.400 1.4e-03
medulloblastoma -1.300 3.5e-04
medulloblastoma, large-cell -2.000 6.3e-06
primitive neuroectodermal tumor 1.200 4.9e-04
adrenocortical carcinoma 1.089 6.4e-03
pancreatic ductal adenocarcinoma liver m... -1.505 8.5e-03
non-small cell lung cancer 1.506 1.9e-21
intraductal papillary-mucinous adenoma (... 1.200 2.0e-03
intraductal papillary-mucinous carcinoma... 1.600 9.1e-04
intraductal papillary-mucinous neoplasm ... 2.100 8.8e-04
lung cancer 1.700 4.7e-05
adult high grade glioma -1.600 2.5e-04
non primary Sjogren syndrome sicca -1.100 1.8e-02
lung adenocarcinoma 1.300 2.3e-10
lung carcinoma 1.500 2.4e-27
spina bifida -1.759 3.8e-02
ulcerative colitis -1.100 9.6e-07

Gene RIF (2)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify sideroflexin 1 (SFXN1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWR      1 - 70
AKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDA     71 - 140
PLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDE    141 - 210
NGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFAT    211 - 280
PLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL                                281 - 322
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15589833 2004 Different dietary fatty acids have dissimilar effects on activity and gene expression of mitochondrial tricarboxylate carrier in rat liver.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15060089 2004 n-6 PUFAs downregulate expression of the tricarboxylate carrier in rat liver by transcriptional and posttranscriptional mechanisms.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14634051 2003 Differential effects of coconut oil- and fish oil-enriched diets on tricarboxylate carrier in rat liver mitochondria.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12150972 2002 Identification and characterization of a novel mitochondrial tricarboxylate carrier.
11722557 2001 Covariance of tricarboxylate carrier activity and lipogenesis in liver of polyunsaturated fatty acid (n-6) fed rats.
11274051 2001 A mutation in a mitochondrial transmembrane protein is responsible for the pleiotropic hematological and skeletal phenotype of flexed-tail (f/f) mice.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8132490 1993 Structure, function and regulation of the tricarboxylate transport protein from rat liver mitochondria.