Property Summary

NCBI Gene PubMed Count 7
PubMed Score 70.36
PubTator Score 27.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0C7M3
Symbols SP-H
NANCI
SFTPH

Gene

  Ortholog (1)

Species Source Disease
Inparanoid OMA EggNOG

Gene RIF (4)

AA Sequence

MRAGFSDFQLIRDQVLFLQDQAQRLTEWLQLSGFENPVSESTTLCLREREKRIPTCVAVCVPSPGTVHTA      1 - 70
LLHPTTLSQSRSSSEAKMLIIHTA                                                   71 - 94
//

Text Mined References (9)

PMID Year Title