Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.46
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRKGLHLFAVFYT      1 - 70
FGNIASIGSTIFLMGPVKQLKRMFEPTRLIATIMVLLCFALTLCSAFWWHNKGLALIFCILQSLALTWYS     71 - 140
LSFIPFARDAVKKCFAVCLA                                                      141 - 160
//

Text Mined References (15)

PMID Year Title