Property Summary

NCBI Gene PubMed Count 45
PubMed Score 67.90
PubTator Score 51.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 7.5e-47
permanent atrial fibrillation 44 4.1e-06
pancreatic cancer 2300 7.1e-04
Disease Target Count Z-score Confidence
Cancer 2346 3.404 1.7
Obesity 616 3.391 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
permanent atrial fibrillation -1.400 4.1e-06
pancreatic cancer -1.300 7.1e-04
psoriasis -2.100 7.5e-47

Gene RIF (35)

PMID Text
26256895 Report reduced hepatic SFRP5 expression in morbidly women with NAFLD.
25382802 The wnt5a/sFRP5 system is altered in human sepsis and might therefore be of interest for future studies on molecular pathophysiology of this common human disease.
25324487 Sfrp5 represents a candidate for a mature adipocyte marker gene.
25139699 Data suggest that serum SFRP5 levels are up-regulated in subjects with newly diagnosed type 2 diabetes as compared to prediabetic or control subjects; subjects were matched for obesity/overweight/body mass index.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
25089371 Serum WISP2 correlated directly with fatty acid binding protein 4. Serum SFRP5 did not differ between obese (n=32) vs. nonobese (n=25) PCOS women, but reference women had lower SFRP5 (p<5x10(-6) as compared to both PCOS groups).
24764263 Secreted frizzled-related protein 5 suppresses inflammatory response in rheumatoid arthritis fibroblast-like synoviocytes through down-regulation of c-Jun N-terminal kinase.
24603290 SFRP5 and WNT5A comprise a balanced duo that may regulate metabolic homeostasis in prepubertal children.
24530778 Serum SFRP5 levels significantly correlated with body mass index, the homeostasis model of assessment of insulin resistance, adiponectin levels, and CAD severity. Low SFRP5 levels may contribute to CAD.
24465779 Therefore, cytokine release and insulin signaling were analyzed to investigate the impact of Sfrp5 on inflammation and insulin signaling in primary human adipocytes and skeletal muscle cells (hSkMC).
24434572 SFRP5 gene methylation in leukemia cells activates Wnt/ss-catenin signaling to upregulate mdr1/P-gp expression and cause multidrug resistance.
24416340 Wnt5a overproduction and SFRP5 deficiency in gastric mucosa may together play an important role in gastric inflammation and carcinogenesis.
24374650 Epigenetic silencing of SFRP5 by hepatitis B virus X protein enhances hepatoma cell tumorigenicity through Wnt signaling pathway
24330025 Serum SFRP5 is regulated by weight status and seems to be correlated with metabolic disorders in children.
24287795 We were able to show a significant association of sFRP5 with both total abdominal and subcutaneous fat. The association signal was only seen in obese males in which the minor allele of rs7072751 explains 1.8 % of variance in total abdominal fat.
23653377 Sfrp5 may play a role in the pathogenesis of T2 Diabetes mellitus.
23290274 Plasma levels of SFRP5 were decreased in Chinese obese and T2DM subjects. SFRP5 was an independent factor affecting glucolipid metabolism, inflammation and insulin resistance.
23215838 Concomitant epigenetic silencing of SOX1 and SFRPs through promoter hypermethylation is frequent in hepatocellular carcinoma, and this might contribute to abnormal activation of canonical Wnt signal pathway.
23185036 Circulating Sfrp5 is likely to play a major role in insulin resistance in humans.
23054609 findings suggest that epithelium-derived SFRP5 may play a probable defensive role in impeding gastric cancer progression, characteristically by inhibiting GEC migration induced by macrophage-derived Wnt5a via JNK signaling activation
23009178 Patients with unmethylated SFRP5 are more likely to benefit from EGFR-TKI therapy.
22384249 Pro-inflammatory wnt5a and anti-inflammatory sFRP5 are differentially regulated by nutritional factors in obese human subjects
21830441 significant decrease in the expression of SFRP1 and SFRP5 was observed in gastric cancer compared with corresponding normal gastric tissues
20811686 This study suggests that a cause of catenin delocalization in oral cancer could be due to WNT pathway activation, by epigenetic alterations of SFRP-1, SFRP-2, SFRP-4, SFRP-5, WIF-1, DKK-3 genes
20795789 Promoter hypermethylation of SFRP5 is associated with Acute myeloid leukemia.
19957335 data suggested that epigenetic silencing of SFRP5 leads to oncogenic activation of the Wnt pathway and contributes to ovarian cancer progression and chemoresistance through the TWIST-mediated EMT and AKT2 signaling
19926868 Observational study of gene-disease association. (HuGE Navigator)
19586554 SFRP5 is downregulated and inversely correlated with MMP-7 and MT1-MMP in gastric cancer
19299079 In multiple myeloma cell lines, hypermethylation of SFRP5 was associated with transcriptional silencing. SFRP5 methylation was restricted to advanced MM stages & plasma-cell leukemia and may play a role in disease progression.
18795670 SFRP5 promoter hypermethylation was significantly more frequent in microsatellite unstable colorectal neoplasms.
18592156 Ectopic expression of SFRPs downregulated T-cell factor transcriptional activity in liver cancer cells, while overexpression of a beta-catenin mutant and depletion of SFRP1 using siRNA synergistically upregulated TCF/LEF transcriptional activity.
18528941 Hypermethylation and aberrant expression of SFRP genes are common in pancreatic cancer, which may be involved in pancreatic carcinogenesis.
18497987 Loss of SFRP5 is associated with oral squamous cell carcinoma
18356147 In its role as tumor suppressor gene. SFRP5 methylation may be a novel DNA-based biomarker potentially useful in clinical breast cancer management.
16609023 The SFRP5 protein gene plays an important role in the pathogenesis of bladder tumor and can be detected using cellular DNA extracted from urine samples.

AA Sequence

MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKR      1 - 70
MRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAVRAGCAPLME     71 - 140
AYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKE    141 - 210
IKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMA    211 - 280
VYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH                                     281 - 317
//

Text Mined References (45)

PMID Year Title
26256895 SFRP5 hepatic expression is associated with non-alcoholic liver disease in morbidly obese women.
25382802 2015 The wingless-related integration site-5a/secreted frizzled-related protein-5 system is dysregulated in human sepsis.
25324487 2014 SFRP5 acts as a mature adipocyte marker but not as a regulator in adipogenesis.
25139699 2015 Circulating SFRP5 levels are elevated in drug-naïve recently diagnosed type 2 diabetic patients as compared with prediabetic subjects and controls.
25107489 2014 Promoter methylation analysis of WNT/?-catenin pathway regulators and its association with expression of DNMT1 enzyme in colorectal cancer.
25089371 2015 Roles of circulating WNT-signaling proteins and WNT-inhibitors in human adiposity, insulin resistance, insulin secretion, and inflammation.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24764263 2014 Secreted frizzled-related protein 5 suppresses inflammatory response in rheumatoid arthritis fibroblast-like synoviocytes through down-regulation of c-Jun N-terminal kinase.
24603290 2014 Balanced duo of anti-inflammatory SFRP5 and proinflammatory WNT5A in children.
24530778 2014 Low serum level of secreted frizzled-related protein 5, an anti-inflammatory adipokine, is associated with coronary artery disease.
24465779 2014 Effect of Sfrp5 on cytokine release and insulin action in primary human adipocytes and skeletal muscle cells.
24434572 2014 Methylation of SFRP5 is related to multidrug resistance in leukemia cells.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24416340 2014 GEC-derived SFRP5 inhibits Wnt5a-induced macrophage chemotaxis and activation.
24374650 2014 Epigenetic silencing of SFRP1 and SFRP5 by hepatitis B virus X protein enhances hepatoma cell tumorigenicity through Wnt signaling pathway.
24330025 2014 SFRP5 correlates with obesity and metabolic syndrome and increases after weight loss in children.
24287795 2014 Common genetic variation in sFRP5 is associated with fat distribution in men.
23653377 2013 Circulating secreted frizzled-related protein 5 (Sfrp5) and wingless-type MMTV integration site family member 5a (Wnt5a) levels in patients with type 2 diabetes mellitus.
23290274 2013 Plasma SFRP5 levels are decreased in Chinese subjects with obesity and type 2 diabetes and negatively correlated with parameters of insulin resistance.
23215838 2013 Frequent concomitant epigenetic silencing of SOX1 and secreted frizzled-related proteins (SFRPs) in human hepatocellular carcinoma.
23185036 2013 Circulating Sfrp5 is a signature of obesity-related metabolic disorders and is regulated by glucose and liraglutide in humans.
23054609 2013 SFRP5 inhibits gastric epithelial cell migration induced by macrophage-derived Wnt5a.
23009178 2012 DNA Methylation status of Wnt antagonist SFRP5 can predict the response to the EGFR-tyrosine kinase inhibitor therapy in non-small cell lung cancer.
22384249 2012 Pro-inflammatory wnt5a and anti-inflammatory sFRP5 are differentially regulated by nutritional factors in obese human subjects.
21830441 Decreased expression and aberrant hypermethylation of the SFRP genes in human gastric cancer.
20811686 2010 WNT pathway in oral cancer: epigenetic inactivation of WNT-inhibitors.
20795789 2010 Acute myeloid leukemia is characterized by Wnt pathway inhibitor promoter hypermethylation.
19957335 2010 Epigenetic silencing of SFRP5 is related to malignant phenotype and chemoresistance of ovarian cancer through Wnt signaling pathway.
19926868 2010 A role for Wnt signaling genes in the pathogenesis of impaired lung function in asthma.
19586554 2009 Downregulation of SFRP5 expression and its inverse correlation with those of MMP-7 and MT1-MMP in gastric cancer.
19299079 2009 Epigenetic dysregulation of secreted Frizzled-related proteins in multiple myeloma.
18981481 2008 Sfrp5 coordinates foregut specification and morphogenesis by antagonizing both canonical and noncanonical Wnt11 signaling.
18795670 Silencing of secreted frizzled-related protein genes in MSI colorectal carcinogenesis.
18592156 2008 Frequent epigenetic inactivation of SFRP genes in hepatocellular carcinoma.
18528941 2008 Hypermethylation and aberrant expression of secreted frizzled-related protein genes in pancreatic cancer.
18497987 2008 Epigenetic inactivation of SFRP genes in oral squamous cell carcinoma.
18356147 2008 Epigenetic inactivation of the secreted frizzled-related protein-5 (SFRP5) gene in human breast cancer is associated with unfavorable prognosis.
16609023 2006 Combination analysis of hypermethylated Wnt-antagonist family genes as a novel epigenetic biomarker panel for bladder cancer detection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10072424 1999 Cloning and characterization of a secreted frizzled-related protein that is expressed by the retinal pigment epithelium.
9642118 1998 Tissue restricted expression of two human Frzbs in preadipocytes and pancreas.
9391078 1997 SARPs: a family of secreted apoptosis-related proteins.
9096311 1997 A family of secreted proteins contains homology to the cysteine-rich ligand-binding domain of frizzled receptors.