Property Summary

NCBI Gene PubMed Count 81
PubMed Score 143.47
PubTator Score 111.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Protein-protein Interaction (2)

Gene RIF (63)

PMID Text
27042933 age-related increases in sFRP2 augment both angiogenesis and metastasis of melanoma cells
26763443 SFRP2 protein plays a role in the ultraviolet rays induced hyperpigmentary disorders.
26517501 Patients with Cytogenetically Normal Primary Acute Myeloid Leukemia and high sFRP2 expression had higher incidence of complete remission rate and better overall survival.
25788689 The distribution of Sfrp2 (and Sfrp1) in the eye is consistent with the idea that they modulate visual pathfinding and axon guidance.
25759530 A combination of GATA5 and SFRP2 methylation could be promising as a marker for the detection and diagnosis of colorectal cancers and adenomas.
25245632 Data suggest that overexpression of secreted frizzled-related protein 2 (sFRP2) gene in mesenchymal stem cells (hMSCs) might improve the therapeutic effectiveness of hMSC transplantation.
25197341 These findings suggest that decreased SFRP2 expression is associated with intermediate/poor karyotypes in acute myeloid leukemia
25189527 The role of SFRP2, as a functional tumor suppressor in the development of oral squamous cell carcinoma, is mediated through inhibition of the Wnt signaling pathway.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
25053594 The risk size of SFRP2 hypermethylation from normal control to adenoma or polyp as well as from adenoma or polyp to colorectal cancer increased gradually
24947038 In hepatitis C virus infected liver tissues hypermethylation at promoter regions of key cancer related genes SFRP2 and DKK1, appears early at chronic hepatitis and liver cirrhosis stages, long before the appearance of hepatocellular carcinoma.
24761891 High SFRP2 gene methylation is associated with ovarian cancer infected with high risk human papillomavirus.
24464051 results show that sFRP-2 is a target gene of hypermethylation in esophageal Basaloid squamous cell carcinoma
24386373 Polymorphisms in several genes involved in the Wnt signaling pathway were associated with hepatic fibrosis or inflammation risk in HCV-infected males.
23226515 SFRP2 appears to interact with Slug to affect the apoptosis of hypertrophic scar fibroblasts
23215838 Concomitant epigenetic silencing of SOX1 and SFRPs through promoter hypermethylation is frequent in hepatocellular carcinoma, and this might contribute to abnormal activation of canonical Wnt signal pathway.
22915211 show that SFRP2 hypermethylation is a common event in prostate cancer. SFRP2 methylation in combination with other epigenetic markers may be a useful biomarker of prostate cancer
22363119 Data suggest that silencing of secreted frizzled-related protein 2 expression through promoter hypermethylation may be a factor in ESCC carcinogenesis through loss of its tumor-suppressive activity.
22246241 Sodium butyrate may modulate the SFRP1/2 expression through histone modification and promoter demethylation causing anti-tumor effects in gastric neoplasms.
22175903 there is a loss of SFRP-2 expression from benign to malignant prostate glands and differential SFRP-2 expression among two possible subgroups of Gleason grade 5 tumours
22136354 Promoter hypermethylation of tumor suppressor SFRP2 is associated with prostate carcinoma.
21709714 A study evaluating the pattern of SFRP2 methylation throughout the promoter during progressive tumorigenesis.
21490961 Among the extracellular regulators that suppress the Wnt pathway, secreted frizzled-related protein 2 (SFRP2), was up-regulated 4.3-fold in healthy smokers and 4.9-fold in COPD smokers.
21463549 serum SFRP2 methylation status represents a promising, non-invasive marker for colorectal carcinoma detection and staging
21409489 Hypermethylation of SFRP2 gene is associated with advanced gastric cancer.
21174795 SFRP2 may play an important role in the development of earlobe keloid, especially at the keloid edge.
20811686 This study suggests that a cause of catenin delocalization in oral cancer could be due to WNT pathway activation, by epigenetic alterations of SFRP-1, SFRP-2, SFRP-4, SFRP-5, WIF-1, DKK-3 genes
20795789 Promoter hypermethylation of SFRP2 is associated with Acute myeloid leukemia.
20723538 Recombinant sFRP2 enhanced Wnt3a-dependent phosphorylation of LRP6 as well as both cytosolic beta-catenin levels and its nuclear translocation. sFRP2 enhanced the Wnt3a-mediated transcription of several genes including DKK1 and NKD1.
20723538 These results support sFRP2's role as an enhancer of Wnt3A/beta-catenin signaling, a result with biological impact for both normal development and diverse pathologies such as tumorigenesis.
20686305 Combined effects of epigenetic alterations in SFRP2 and point mutations in K-ras protein play a role in development of mucinous type anal adenocarcinoma.
20682398 Investigated the methylation of the SFRP2, P16, DAPK1, HIC1, and MGMT genes, as well as the mutation of amino acid codons 12 and 13 of the KRAS gene in normal and tumor tissue DNA of patients diagnosed with sporadic colorectal cancer.
20682398 Observational study of gene-disease association. (HuGE Navigator)
20602801 induces transient rise of intracellular Ca2+ via emptying of intracellular calcium stores in neutrophils
20596629 SFRP2 promoter methylation is aberrant in mesothelioma.
20501806 This is the first report documenting that sFRP2 activates the canonical Wnt pathway and promotes cell growth by evoking diverse signaling cascades in renal cancer cells.
20403915 Observational study of gene-disease association. (HuGE Navigator)
20208569 Loss of WNT pathway inhibition due to SFRP2 gene silencing is associated with medulloblastoma.
20030932 Hypermethylation of SFRP1 and 2 was present in nine malignant hematopoietic cell lines.
19946729 cGMP-phosphodiesterase 6 can be activated by another cancer-retina antigen, transducin, through Wnt5a-Frizzled-2 cascade, which leads to a lowering of cGMP and an increase in intracellular calcium mobilization.
19926868 Observational study of gene-disease association. (HuGE Navigator)
19593212 Observational study of gene-disease association. (HuGE Navigator)
19513569 SDF-2, SDF-4 and SDF-5 are expressed in mammary tissues and cells and that a reduced level of SDF-2 and SDF-4 are associated with a poor clinical outcome.
19458075 SFRP2 is a novel stimulator of angiogenesis that stimulates angiogenesis via a calcineurin/NFAT pathway and may be a favorable target for the inhibition of angiogenesis in solid tumors.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19299079 In multiple myeloma cell lines, aberrant promoter hypermethylation of the secreted Frizzled-related protein genes was a common event, and hypermethylation of SFRP2 was associated with transcriptional silencing.
19095296 Restoration of the expression of SFRP1 and SFRP2 attenuated Wnt signaling in CaSki cells, decreased abnormal accumulation of free beta-catenin in the nucleus, and suppressed ovarian cancer cell growth.
18990230 SFRP2 gene is a high-frequent target of epigenetic inactivation in human breast cancer; its methylation leads to abrogation of SFRP2 expression, conferring a growth advantage to epithelial mammary cells; this supports a tumor suppressive function of SFRP2
18795670 SFRP2 promoter hypermethylation was more frequent in microsatellite unstable colorectal neoplasms.
18592156 Ectopic expression of SFRPs downregulated T-cell factor/lymphocyte enhancer factor (TCF/LEF) transcriptional activity in liver cancer cells.
18528941 Hypermethylation and aberrant expression of SFRP genes are common in pancreatic cancer, which may be involved in pancreatic carcinogenesis.
18497987 Loss of SFRP2 is associated with oral squamous cell carcinoma
18404682 Aberrant DNA methylation and histone modifications work together to silence the sFRP2 gene in renal cell carcinoma (RCC) cells.
18079202 Reduced tumor expression of Wnt inhibitory factor-1 (WIF1), sFRP2, and sFRP4 mRNA was confirmed in all pituitary tumors.
17848950 Epigenetic inactivation of SFRP2 is associated with gastric carcinogenesis
17639423 SFRP2 methylation may serve as a marker for molecular stool-based adenoma and colorectal cancer screening.
17410438 Aberrant methylated SFRP2 could be detected frequently in stools from patients with CRC and precancerous lesions. Methylation testing of fecal DNA may be a simple, promising, and noninvasive screening tool for colorectal neoplasia.
17352030 Methylation testing of fecal DNA using a panel of epigenetic markers (methylated SFRP2, HPP1 and MGMT) may be a simple and promising non-invasive screening method for colorectal carcinoma and precancerous lesions.
16609023 The SFRP2 protein gene plays an important role in the pathogenesis of bladder tumor and can be detected using cellular DNA extracted from urine samples.
16407829 SFRP2 was methylated in 73% of the normal squamous esophageal mucosa samples.
15094274 identified SFRP2 methylation as a sensitive single DNA-based marker for identification of colorectal cancer in stool samples
14709558 secreted Frizzled-related protein 2 induces cellular resistance to apoptosis
14561758 SFRP2 is a target of the Pax2 transcription factor

AA Sequence

MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMK      1 - 70
EVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDML     71 - 140
ECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDT    141 - 210
KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQ    211 - 280
REFKRISRSIRKLQC                                                           281 - 295
//

Text Mined References (81)

PMID Year Title
27042933 2016 sFRP2 in the aged microenvironment drives melanoma metastasis and therapy resistance.
26763443 2016 Secreted Frizzled-Related Protein 2 (sFRP2) Functions as a Melanogenic Stimulator; the Role of sFRP2 in UV-Induced Hyperpigmentary Disorders.
26517501 2015 Prognostic Significance of Secreted Frizzled-Related Protein 2 Expression in Cytogenetically Normal Primary Acute Myeloid Leukemia.
25788689 2015 Secreted frizzled related proteins modulate pathfinding and fasciculation of mouse retina ganglion cell axons by direct and indirect mechanisms.
25759530 2015 Combined detection of plasma GATA5 and SFRP2 methylation is a valid noninvasive biomarker for colorectal cancer and adenomas.
25245632 2015 Enhanced human mesenchymal stem cell survival under oxidative stress by overexpression of secreted frizzled-related protein 2 gene.
25197341 2014 Decreased SFRP2 expression is associated with intermediate and poor karyotypes in de novo acute myeloid leukemia.
25189527 2014 Secreted frizzled?related protein 2 is epigenetically silenced and functions as a tumor suppressor in oral squamous cell carcinoma.
25107489 2014 Promoter methylation analysis of WNT/?-catenin pathway regulators and its association with expression of DNMT1 enzyme in colorectal cancer.
25053594 2014 Variation risks of SFRP2 hypermethylation between precancerous disease and colorectal cancer.
24947038 2014 Promoter hypermethylation of Wnt pathway inhibitors in hepatitis C virus - induced multistep hepatocarcinogenesis.
24761891 2014 Methylation of SFRPs and APC genes in ovarian cancer infected with high risk human papillomavirus.
24464051 2014 Downregulation of sFRP-2 by epigenetic silencing activates the ?-catenin/Wnt signaling pathway in esophageal basaloid squamous cell carcinoma.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24386373 2013 WNT signaling pathway gene polymorphisms and risk of hepatic fibrosis and inflammation in HCV-infected patients.
23226515 2012 SFRP2 and slug contribute to cellular resistance to apoptosis in hypertrophic scars.
23215838 2013 Frequent concomitant epigenetic silencing of SOX1 and secreted frizzled-related proteins (SFRPs) in human hepatocellular carcinoma.
22915211 2013 Gene expression and epigenetic discovery screen reveal methylation of SFRP2 in prostate cancer.
22363119 2012 Epigenetic inactivation of secreted frizzled-related protein 2 in esophageal squamous cell carcinoma.
22246241 2012 Change in gene expression profiles of secreted frizzled-related proteins (SFRPs) by sodium butyrate in gastric cancers: induction of promoter demethylation and histone modification causing inhibition of Wnt signaling.
22175903 2011 The role of secreted frizzled-related protein 2 expression in prostate cancer.
22136354 2012 Alterations in promoter methylation status of tumor suppressor HIC1, SFRP2, and DAPK1 genes in prostate carcinomas.
21709714 2011 Expansion of CpG methylation in the SFRP2 promoter region during colorectal tumorigenesis.
21490961 2011 Down-regulation of the canonical Wnt ?-catenin pathway in the airway epithelium of healthy smokers and smokers with COPD.
21463549 2011 Diagnostic and prognostic value of the methylation status of secreted frizzled-related protein 2 in colorectal cancer.
21409489 2011 Aberrant gene methylation is a biomarker for the detection of cancer cells in peritoneal wash samples from advanced gastric cancer patients.
21174795 2010 [Significance of the secreted frizzled-related protein 2 expression in earlobe keloid].
20811686 2010 WNT pathway in oral cancer: epigenetic inactivation of WNT-inhibitors.
20795789 2010 Acute myeloid leukemia is characterized by Wnt pathway inhibitor promoter hypermethylation.
20723538 2010 Secreted Frizzled-related protein-2 (sFRP2) augments canonical Wnt3a-induced signaling.
20686305 2010 Epigenetic inactivation of tumor suppressor SFRP2 and point mutation in KRAS proto-oncogene in fistula-associated mucinous type anal adenocarcinoma: report of two cases.
20682398 2010 Gene methylation of SFRP2, P16, DAPK1, HIC1, and MGMT and KRAS mutations in sporadic colorectal cancer.
20602801 2010 The FPR2-induced rise in cytosolic calcium in human neutrophils relies on an emptying of intracellular calcium stores and is inhibited by a gelsolin-derived PIP2-binding peptide.
20596629 2010 Aberrant promoter methylation of WIF-1 and SFRP1, 2, 4 genes in mesothelioma.
20501806 2010 Oncogenic functions of secreted Frizzled-related protein 2 in human renal cancer.
20403915 2010 Single nucleotide polymorphisms in Wnt signaling and cell death pathway genes and susceptibility to colorectal cancer.
20208569 2010 The SFRP family of WNT inhibitors function as novel tumor suppressor genes epigenetically silenced in medulloblastoma.
20030932 2009 [Methylation status of CpG islands in secreted frizzled-related protein gene promoter region of malignant hematopoietic cell lines].
19946729 2010 cGMP-phosphodiesterase 6, transducin and Wnt5a/Frizzled-2-signaling control cGMP and Ca(2+) homeostasis in melanoma cells.
19926868 2010 A role for Wnt signaling genes in the pathogenesis of impaired lung function in asthma.
19593212 2009 Novel genetic variants contributing to left ventricular hypertrophy: the HyperGEN study.
19513569 2009 Transcript analyses of stromal cell derived factors (SDFs): SDF-2, SDF-4 and SDF-5 reveal a different pattern of expression and prognostic association in human breast cancer.
19458075 2009 Secreted frizzle-related protein 2 stimulates angiogenesis via a calcineurin/NFAT signaling pathway.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19389651 2009 Genome-wide association study of electrocardiographic conduction measures in an isolated founder population: Kosrae.
19299079 2009 Epigenetic dysregulation of secreted Frizzled-related proteins in multiple myeloma.
19095296 2009 SFRP1 and SFRP2 suppress the transformation and invasion abilities of cervical cancer cells through Wnt signal pathway.
18990230 2008 Promoter hypermethylation of the SFRP2 gene is a high-frequent alteration and tumor-specific epigenetic marker in human breast cancer.
18795670 Silencing of secreted frizzled-related protein genes in MSI colorectal carcinogenesis.
18592156 2008 Frequent epigenetic inactivation of SFRP genes in hepatocellular carcinoma.
18528941 2008 Hypermethylation and aberrant expression of secreted frizzled-related protein genes in pancreatic cancer.
18497987 2008 Epigenetic inactivation of SFRP genes in oral squamous cell carcinoma.
18404682 2008 DNA methylation and histone modifications cause silencing of Wnt antagonist gene in human renal cell carcinoma cell lines.
18079202 2008 Wnt pathway inhibitors are strongly down-regulated in pituitary tumors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17848950 2007 Frequent epigenetic inactivation of secreted frizzled-related protein 2 (SFRP2) by promoter methylation in human gastric cancer.
17639423 2008 SFRP2 methylation in fecal DNA--a marker for colorectal polyps.
17471511 2007 Structure-function analysis of secreted frizzled-related protein-1 for its Wnt antagonist function.
17410438 2007 Hypermethylation of SFRP2 as a potential marker for stool-based detection of colorectal cancer and precancerous lesions.
17352030 2007 Detection of aberrant methylation in fecal DNA as a molecular screening tool for colorectal cancer and precancerous lesions.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16609023 2006 Combination analysis of hypermethylated Wnt-antagonist family genes as a novel epigenetic biomarker panel for bladder cancer detection.
16407829 2006 Alterations of the Wnt signaling pathway during the neoplastic progression of Barrett's esophagus.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15094274 2004 Methylation changes in faecal DNA: a marker for colorectal cancer screening?
14709558 2004 Autocrine/paracrine secreted Frizzled-related protein 2 induces cellular resistance to apoptosis: a possible mechanism of mammary tumorigenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14561758 2003 The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12055200 2002 Regulation of Wnt signaling during adipogenesis.
10980594 2000 Secreted Frizzled-related proteins inhibit motility and promote growth of human malignant glioma cells.
10654605 2000 SHH-N upregulates Sfrp2 to mediate its competitive interaction with WNT1 and WNT4 in the somitic mesoderm.
10072424 1999 Cloning and characterization of a secreted frizzled-related protein that is expressed by the retinal pigment epithelium.
9853965 1998 sFRP-2 is a target of the Wnt-4 signaling pathway in the developing metanephric kidney.
9642118 1998 Tissue restricted expression of two human Frzbs in preadipocytes and pancreas.
9391078 1997 SARPs: a family of secreted apoptosis-related proteins.
9096311 1997 A family of secreted proteins contains homology to the cysteine-rich ligand-binding domain of frizzled receptors.