Property Summary

NCBI Gene PubMed Count 153
PubMed Score 259.67
PubTator Score 316.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
malignant mesothelioma 1.200 1.2e-02
astrocytic glioma -1.500 3.4e-02
ependymoma -1.900 3.0e-02
psoriasis -2.400 8.8e-09
cystic fibrosis 5.562 5.8e-08
glioblastoma -1.200 3.6e-02
atypical teratoid / rhabdoid tumor 1.700 2.4e-02
sonic hedgehog group medulloblastoma 3.500 1.8e-05
primitive neuroectodermal tumor 2.100 2.2e-02
ulcerative colitis -1.084 3.5e-02
autosomal dominant Emery-Dreifuss muscul... 1.015 2.7e-02
intraductal papillary-mucinous adenoma (... -2.800 2.4e-04
intraductal papillary-mucinous carcinoma... -3.000 2.6e-04
intraductal papillary-mucinous neoplasm ... -3.000 3.7e-03
colon cancer -3.700 1.2e-05
lung cancer -2.100 4.2e-04
breast carcinoma -3.100 5.2e-30
interstitial cystitis 1.700 2.8e-03
pilocytic astrocytoma -1.200 1.4e-02
aldosterone-producing adenoma -1.059 4.1e-02
subependymal giant cell astrocytoma -2.416 1.5e-02
invasive ductal carcinoma -5.200 9.4e-04
Breast cancer -6.300 3.6e-28
Pick disease -1.100 4.4e-02
ductal carcinoma in situ -1.800 2.6e-02
ovarian cancer -4.800 1.9e-13
Down syndrome 2.300 2.7e-04
chronic rhinosinusitis -2.174 6.5e-03

Gene RIF (132)

PMID Text
26851021 Hepatocellular carcinoma patients with high SFRP1 expression in tumor tissue had a significantly better overall survival rate.
26643984 Results show that SNPs rs4736958 and rs7832767 of SFRP1 gene were significantly associated with tuberculosis susceptibility and might influence the expression levels of inflammatory markers of tuberculosis patients in a Chinese Han population.
26482433 Hypermethylation of the selected markers (MAL, PRIMA1, PTGDR and SFRP1) can result in reduced gene expression and may contribute to the formation of colorectal cancer.
26413870 The increased placental expression of sFRP1 seen in smokers impairs fetal growth by inhibiting WNT signaling and trophoblast proliferation.
26397159 Down-regulation of SFRP1 is associated with recurrence in Endometrioid Adenocarcinoma.
26337424 in gliomas there was correlation of SFRP1 methylation with tumor grade and patients' survival
26276746 SFRP1 downregulation may result from epigenetic silencing and is associated with worse survival in nasopharyngeal carcinoma
26164457 SFRP1 is a direct target of MiR-27a in the regulation of glioma invasion and cell migration.
25809273 In human mammary epithelial cells with either SFRP1 knocked down (TERT-siSFRP1) and rescued SFRP1 expression (MCF7-SFRP1), estrogen signaling is augmented.
25788689 Sfrp1 contributes to coordination of visual axon growth in retinal ganglion cells.
25732201 Knockdown of SFRP1 expression in RT112 cells resulted only in marginal effects.
25652468 the DNA methylation levels of OPCML and SFRP1 could be potential biomarkers for diagnosis of CCA with high specificity, sensitivity, and accuracy, in particular for biopsy specimens
25432334 sFRP1 protein displays antineoplastic activity.
25347432 Reduced SFRP1 expression is associated with acute myeloid leukemia.
25046226 study indicates that increased expression of both SFRP1 and SFRP3 may contribute to the pathogenesis of IUGR placental dysfunction, whereas the loss of these proteins may be involved in the development of human trophoblastic tumors.
25036590 While SFRP1 re-expression generally mediated distinct patterns of transcriptionally induced or repressed genes in BT20 and SKBR3 cells, BDNF was a SFRP1-induced gene in both cell lines.
25033833 The mechanisms by which tumor suppressor SFRP1 influences carcinogenic properties of cancer cells do not rely on Wnt signaling, thereby demonstrating the complexity of tumor associated signaling pathways.
24949429 Coexpression of SFRP1 and WIF1, rather than SFRP1 or WIF1 alone, could be used, together with low TNM stage, as a prognostic predictor of favorable outcomes in CRC.
24929326 Studies indicate that secreted frizzled-related protein 1 (SFRP1) promoter methylation was strongly correlated with colorectal carcinogenesis among both Asians and Caucasians (all P < 0.05).
24761891 High SFRP1 gene methylation is associated with ovarian cancer infected with high risk human papillomavirus.
24695522 Our study provided the first evidence that SNPs in CTNNB1 and SFRP1 were associated with tuberculosis risk, and genetic variants in Wnt signaling pathway might participate in genetic susceptibility to tuberculosis in Chinese Han population.
24643460 Results provide evidence that SFRP1 is a clinically important determinant of taxanes resistance in human advanced lung adenocarcinoma (LAD) cells, suggesting that it might be a novel therapeutic target for the treatment of taxane-resistant LAD patients.
24625818 miR-27a induced gene silencing contributes to bone metabolism in hFOB cells in vitro, which is partly affected by the post-transcriptional regulation of sFRP1, during osteoblast proliferation, apoptosis and differentiation.
24594839 results demonstrate that SFRP1 is a favorable prognostic factor for human BTC and that its expression inversely correlates with that of beta-catenin
24504368 Data suggest genistein exerts its anti-tumour effect via downregulation of miR-1260b that targeted sRRP1 and Smad4 genes in prostate cancer cells. Expression of sFRP1 and Smad4 was modulated via DNA methylation or histone modifications in PC.
24454902 Hypermethylation of SFRP1 predicts poorer survival in patients with clear cell renal cell carcinoma.
24386373 Polymorphisms in several genes involved in the Wnt signaling pathway were associated with hepatic fibrosis or inflammation risk in HCV-infected males.
24374650 Epigenetic silencing of SFRP1 by hepatitis B virus X protein enhances hepatoma cell tumorigenicity through Wnt signaling pathway
24305703 Low SFRP1 expression is associated with glioma.
24133576 This is the first study to describe an association of the SFRP1 SNP rs3242 and bladder cancer risk as well as the influence of rs3242 on genotype-dependent microRNA capacity on SFRP1 mRNA.
24127655 Epigallocatechin-3-gallate induces reexpression of the transcriptionally silenced SFRP1 gene in hepatoblastoma cells.
24096618 We observed strong up-regulation of SFRP1 expression in all meningiomas with AKT1E17K mutation
24080158 secreted FRP1 either inhibits or enhances signaling in the Wnt3a/beta-catenin pathway
23927957 sFRP1 is a biomarker for aggressive subgroups of human gastric cancer and a prognostic biomarker for patients with poor survival.
23802127 sFRP1, an endogenous antagonist of the Wnt pathway, inhibits TGF-beta1-induced EMT.
23770846 HCV core-induced epigenetic silencing of SFRP1 may lead to the activation of the Wnt signaling pathway and thus contribute to HCC aggressiveness through induction of EMT.
23698475 The SFRP1 promoter region is hypermethylated in systemic sclerosis patients' fibroblasts and PBMCs compared to controls, leading to decreased SFRP1 expression and aberrant Wnt signalling.
23572277 Studied the expression of TCF/LEF and SFRP family members (SFRP1 and SFRP3) to gain a better understanding of biological signaling pathways responsible for epidemiology and clinical parameters of clear cell RCC (cRCC).
23467623 The basal-like subtype is associated with low methylation levels of the SFRP1 gene.
23449484 Increased expression of SFRP-1 and LC3 was observed in keratoconus corneas.
23441124 Evidence that tear-protein SFRP1 levels are altered in keratoconus (KC) suggests the involvement of SFRPs in the pathogenesis of KC.
23215838 Concomitant epigenetic silencing of SOX1 and SFRPs through promoter hypermethylation is frequent in hepatocellular carcinoma, and this might contribute to abnormal activation of canonical Wnt signal pathway.
23159077 SFRP1 gene methylation is closely associated with carcinogenesis and development of non-small cell lung cancer. 5-Aza-CdR may reverse the methylation of SFRP1, p16 and MGMT genes, and facilitate the re-expression of the anti-oncogenes.
22927647 evidence presented suggesting that SFRP1 functions as a secreted mediator of senescence through inhibition of Wnt signaling and activation of the retinoblastoma pathway and that cancer-associated SFRP1 mutants are defective for senescence induction
22576962 our study identified Gremlin 1, FRP, and Dkk-1 as natural brakes on hypertrophic differentiation in articular cartilage.
22351518 Epigenetic silencing of sFRP1 activates the canonical Wnt pathway and contributes to increased cell growth and proliferation in hepatocellular carcinoma
22296502 Promoter hypermethylation of FRP1 leading to gene inactivation is associated with hepatocellular carcinoma.
22246241 Sodium butyrate may modulate the SFRP1/2 expression through histone modification and promoter demethylation causing anti-tumor effects in gastric neoplasms.
22178351 study reports data of association studies with osteoporosis related parameters and sFRP1 in men; also show significant associations between genetic variation in sFRP1 and adiposity related parameters
22031861 Data identified SFRP1 as a transcriptional repression target of the t(8;21) fusion protein and demonstrated a novel mechanism of Wnt activation in a specific subtype of acute myeloid leukemia (AML).
21830441 significant decrease in the expression of SFRP1 and SFRP5 was observed in gastric cancer compared with corresponding normal gastric tissues
21567192 Promoter hypermethylation of SFRP1 is a frequent event in esophageal squamous cell carcinoma.
21402050 The association of thrombospondin-1 and FRP1 is primarily mediated by the amino-terminal N-module of thrombospondin-1 and the netrin domain of FRP1.
21344486 WNT1 and SFRP1 mRNA levels were higher in DU145 cells compared to non-osteotropic cells.
21046672 Reduced expression of the sFRP1 protein was frequently observed in Chinese patients with hepatocellular carcinoma, which may at least partially result from the genetic instability, especially loss of heterozygosity.
20856206 SFRP-1 and the SFRP-like molecule V3Nter can inhibit tumor growth of beta-catenin-activated tumor cells in vivo
20848536 reduced SFRP1 expression has been associated with malignancy, low myofibroblast expression of this Wnt inhibitor may be implicated in increased risk of cancer in ulcerative colitis.
20823417 integrative genomics approach to a large cohort of medulloblastomas has identified four disparate subgroups (SFRP1) with distinct demographics, clinical presentation, transcriptional profiles, genetic abnormalities, and clinical outcome.
20811686 This study suggests that a cause of catenin delocalization in oral cancer could be due to WNT pathway activation, by epigenetic alterations of SFRP-1, SFRP-2, SFRP-4, SFRP-5, WIF-1, DKK-3 genes
20685720 Downregulation of SFRP1 is associated with recurrence in meningiomas.
20596629 SFRP1 promoter methylation is aberrant in mesothelioma.
20595636 Data demonstrate that SFRP1 promotes normal alveolar formation in lung development, although its expression in the adult up-regulates proteins that can cause tissue destruction.
20471677 Transcriptional down-regulation of the Wnt antagonist SFRP1 in haematopoietic cells of patients with different risk types of MDS.
20353273 epigenetic inactivation of SFRP1 is a common event contributing to lung carcinogenesis and maybe used as a potential biomarker for NSCLC in Chinese population.
20208569 Loss of WNT pathway inhibition due to SFRP1 gene silencing is associated with medulloblastoma.
20162454 Methylation of the SFRP1 gene was the major cause of reduced SFRP1 expression which led to Cytoplasm/Nucleus accumulation of beta-catenin and was associated with tumor malignancy.
20030932 Hypermethylation of SFRP1 and 2 was present in nine malignant hematopoietic cell lines.
19737074 The overall results of this study suggest that although the inhibitors of Wnt pathway promote early chondrogenesis of mesenchymal stem cells (MSCs), they do not provide an ultimately enhancing role in the cartilage tissue engineering of MSCs.
19730886 SFRP1 and SFRP4 appear to be candidate markers for colorectal carcinoma. Unlike SFRP1 as a negative regulator for CRC carcinogenesis, SFRP4 may play quite different biological role in CRC.
19723665 SFRP1 plays a role in the metastatic potential of renal cell carcinomas
19702942 These results suggest that the SFRP1 may be a candidate gene for a BMD determinant
19702942 Observational study of gene-disease association. (HuGE Navigator)
19690140 Wnt antagonist sFRP1 inhibits Wnt signaling and exerts potent antitumor activity by increasing the apoptosis rate in tumor cells and by impairing tumor vascularization
19569235 Down-regulation of SFRP1 can be triggered by epigenetic and/or genetic events and may contribute to the tumourigenesis of human breast cancer through both canonical and non-canonical WNT signalling pathways.
19565266 Inclusion of the SFRP1 gene into a set of 11 genes has improved the bladder cancer detection.
19543515 increased frequency of promoter hypermethylation in SFRP1 gene in acute myeloid leukemia compared to chronic myeloid leukemia.
19473496 WNT signaling enhances breast cancer cell motility and blockade of the WNT pathway by sFRP1 suppresses MDA-MB-231 xenograft growth
19453261 Observational study of gene-disease association. (HuGE Navigator)
19299079 In multiple myeloma cell lines, aberrant promoter hypermethylation of the secreted Frizzled-related protein genes was a common event, and hypermethylation of SFRP1 was associated with transcriptional silencing.
19277043 Secreted Frizzled-related protein-1 is a negative regulator of androgen receptor activity in prostate cancer.
19118898 sFRP1 promoter methylation is associated with persistent Philadelphia chromosome in chronic myeloid leukemia.
19095296 Restoration of the expression of SFRP1 and SFRP2 attenuated Wnt signaling in CaSki cells, decreased abnormal accumulation of free beta-catenin in the nucleus, and suppressed ovarian cancer cell growth.
19053830 sFRP1 can be inhibited by diarylsulfone sulfonamides, affecting osteoblast proliferation, differentiation, and bone mineral density, quality, and strength
18976975 Knockdown of secreted frizzled-related protein 1 (SFRP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18949430 methylation-associated silencing of SFRP1 frequently occurs in renal cell carcinoma and plays a pivotal role in early carcinogenesis
18941195 The soluble frizzled-related protein (FRP)1 family is implicated as possible mediators in hormone down-regulation of the earliest events in lymphopoiesis.
18795670 All colorectal neoplasms samples showed hypermethylation in the promoter region of SFRP1
18774388 Observational study of gene-disease association. (HuGE Navigator)
18706212 Data shows that aberrant expression of Wnt antagonist SFRP1 in pancreatic cancer
18639284 SFRP1 is hypermethylated in renal cell carcinoma.
18592156 Ectopic expression of SFRPs downregulated T-cell factor transcriptional activity in liver cancer cells, while overexpression of a beta-catenin mutant and depletion of SFRP1 using siRNA synergistically upregulated TCF/LEF transcriptional activity.
18528941 Hypermethylation and aberrant expression of SFRP genes are common in pancreatic cancer, which may be involved in pancreatic carcinogenesis.
18497987 Loss of SFRP1 is associated with oral squamous cell carcinoma
18371946 Forced expression of SFRP1 in cultured prostatic epithelial cells led to sustained activation of JNK that was essential for SFRP1-induced epithelial proliferation.
18274669 increased expression of sFRP1 in trabecular meshwork (TM) appears to be responsible for elevated IOP in glaucoma and restoring Wnt signaling in the TM may be a novel disease intervention strategy for treating glaucoma.
18156211 sFRP-1 can interact with Wnt receptors Frizzled 4 and 7 on endothelial cells to transduce downstream to cellular machineries requiring Rac-1 activity in cooperation with GSK-3beta
18035687 Epigenetic inactivation by methylation is the predominant mechanism of SFRP1 gene silencing in breast cancer.
17699851 The data support a role for sFRP1 as a tumor suppressor in clear cell renal cell carcinoma and perhaps loss of sFRP1 is an early, aberrant molecular event in renal cell carcinogenesis.
17626620 Down-regulation of SFRP1 as a candidate tumor suppressor gene, triggered by the epigenetic and/or genetic events, could contribute to the oncogenesis of hepatic cell carcinoma.
17544413 Wnt3A treatment significantly activated human hepatic stellate cells, while this was inhibited in secreted frizzled-related protein 1 (sFRP1) overexpressing cells.
17500071 sFRP-1 is post-translationally modified by tyrosine sulfation at tyrosines 34 and 36, which is inhibited by the treatment of heparin
17485441 DKK1 and SFRP1 inhibit the transformed phenotype of breast cancer cell lines, and DKK1 inhibits tumor formation.
17471511 Structure-function analysis of SFRP1 for its Wnt antagonist function is reported.
17465504 SFRP1 inactivation is a common and early event caused mainly by hypermethylation in gastric cancer. SFRP1 expression loss may be correlated with tumor metastasis in primary gastric cancer.
17443492 knocking down SFRP1 by RNA interference in beta-catenin-deficient cell lines (SK-Hep1) stimulated Wnt signaling and promoted cell growth. Data suggested that SFRP1 suppressed liver cancer cells growth through Wnt canonical signaling
17353908 Promoter hypermethylation seems to be the predominant mechanism of SFRP1 gene silencing in renal cell carcinoma and may contribute to initiation and progression of this disease.
17035233 sFRP-1, a target gene of the hedgehog pathway, is involved in cross-talk between the hedgehog pathway and the Wnt pathway
16775427 Epigenetic SFRP1 inactivation is associated with urothelial carcinoma
16609023 The SFRP1 protein gene plays an important role in the pathogenesis of bladder tumor and can be detected using cellular DNA extracted from urine samples.
16532032 Represses Wnt signaling in breast tissue, and its downregulation contributes to the activation of Wnt signaling.
16523202 study identifies sFRP1 inactivation at the premalignant stage of colorectal cancer development, indicating that these pathways may be useful targets for chemoprevention strategies in this common solid tumour
16449975 promoter hypermethylation is the predominant mechanism of SFRP1 gene silencing in human breast cancer
16423993 Significant methylation and silencing of SFRP1 in CLL samples suggests its potential as a major contributor to leukomogenesis
16410723 These findings suggest that frequent downregulation of SFRP1 expression in breast cancer can be attributed, in large part, to aberrant promoter hypermethylation in conjunction with or without histone deacetylation.
16410684 SFRP1 transcripts were shown to be downregulated in 90% (45/50) of the bladder tumors as compared with the normal bladder tissue.
16407829 Inactivating SFRP1 methylation occurred in all Barrett esophagus samples and in 96% of esophageal adenocarcinomas.
16328026 Results indicate that SFRP1 is the Hedgehog target to confine canonical WNT signaling within stem or progenitor cells.
16288033 Data suggest that overexpression of SFRP1 by prostatic tumor stroma may account for the previously reported capacity of prostatic tumor stroma to provide a pro-proliferative paracrine signal to adjacent epithelial cells.
16149051 These results establish sFRP-1 as an important negative regulator of human osteoblast and osteocyte survival.
16007200 SFRP 1 gene is frequently downregulated by promoter hypermethylation and suppresses tumor growth activity of lung cancer cells, which suggests that SFRP 1 is a candidate tumor suppressor gene for lung cancer
15886250 orbital adipogenesis is enhanced in Grave's ophthalmopathy and elevated levels of sFRP-1 in the orbit may be involved in stimulating this pathogenic process
15677765 findings suggest that Secreted frizzled-related proteins 1 (SFRP1) modulates glucocorticoid-induced bone loss
15335268 Some hyperplastic polyps from patients with hyperplastic polyposis coli syndrome show a secreted Frizzled receptor protein 1 immunophenotype that could indicate alterations of cellular growth control.
15235574 Our data, so far, exclude SFRP1 as a molecular cause of RD (retinal dystrophies)
14581477 the constitutive up-regulation of SFRP1 could be an adaptive cell survival mechanism
12925876 Antibodies raised against the human fusion regulatory protein 1 (FRP-1; CD98) molecule suppress cell fusion mediated by HIV-1 gp160
12413893 These results indicate that the human secreted frizzled-related protein (hsFRP) gene probably functions as a tumor suppressor in normal cervical epithelium and down-regulation of hsFRP contributes to development of cervical cancer.
11741940 In this study, the disulfide linkages of recombinant sFRP-1 were determined
9403839 Antibodies raised against the human fusion regulatory protein 1 (FRP-1; CD98) molecule suppress cell fusion mediated by HIV-1 gp160
9138296 Antibodies raised against the human fusion regulatory protein 1 (FRP-1; CD98) molecule suppress cell fusion mediated by HIV-1 gp160
8922468 Antibodies raised against the human fusion regulatory protein 1 (FRP-1; CD98) molecule suppress cell fusion mediated by HIV-1 gp160
7561057 Antibodies raised against the human fusion regulatory protein 1 (FRP-1; CD98) molecule suppress cell fusion mediated by HIV-1 gp160

AA Sequence

MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHN      1 - 70
VGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSC     71 - 140
EPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALR    141 - 210
MKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYL    211 - 280
LTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK                                        281 - 314
//

Text Mined References (154)

PMID Year Title
26851021 2016 Loss of SFRP1 Expression Is Associated with Poor Prognosis in Hepatocellular Carcinoma.
26643984 2016 SFRP1 variations influence susceptibility and immune response to Mycobacterium tuberculosis in a Chinese Han population.
26482433 2015 DNA hypermethylation and decreased mRNA expression of MAL, PRIMA1, PTGDR and SFRP1 in colorectal adenoma and cancer.
26413870 2015 Excess placental secreted frizzled-related protein 1 in maternal smokers impairs fetal growth.
26397159 2016 Expression Patterns of the Wnt Pathway Inhibitors Dickkopf3 and Secreted Frizzled-Related Proteins 1 and 4 in Endometrial Endometrioid Adenocarcinoma: An NRG Oncology/Gynecologic Oncology Group Study.
26337424 2016 Wnt pathway antagonists, SFRP1, SFRP2, SOX17, and PPP2R2B, are methylated in gliomas and SFRP1 methylation predicts shorter survival.
26276746 2015 Low SFRP1 Expression Correlates with Poor Prognosis and Promotes Cell Invasion by Activating the Wnt/?-Catenin Signaling Pathway in NPC.
26164457 2015 MiR-27a regulates Wnt/beta-catenin signaling through targeting SFRP1 in glioma.
25809273 2015 Estrogen-mediated signaling is differentially affected by the expression levels of Sfrp1 in mammary epithelial cells.
25788689 2015 Secreted frizzled related proteins modulate pathfinding and fasciculation of mouse retina ganglion cell axons by direct and indirect mechanisms.
25732201 2015 Functional analyses and prognostic significance of SFRP1 expression in bladder cancer.
25652468 2015 DNA methylation level of OPCML and SFRP1: a potential diagnostic biomarker of cholangiocarcinoma.
25432334 2015 Expression, purification, and therapeutic implications of recombinant sFRP1.
25347432 2015 Clinical significance of reduced SFRP1 expression in acute myeloid leukemia.
25046226 2014 Immunohistochemical expression of SFRP1 and SFRP3 proteins in normal and malignant reproductive tissues of rats and humans.
25036590 2014 BDNF is associated with SFRP1 expression in luminal and basal-like breast cancer cell lines and primary breast cancer tissues: a novel role in tumor suppression?
25033833 2014 Influence of secreted frizzled receptor protein 1 (SFRP1) on neoadjuvant chemotherapy in triple negative breast cancer does not rely on WNT signaling.
24949429 2014 Coexpression of SFRP1 and WIF1 as a prognostic predictor of favorable outcomes in patients with colorectal carcinoma.
24929326 2014 Aberrant promoter methylation of the SFRP1 gene may contribute to colorectal carcinogenesis: a meta-analysis.
24761891 2014 Methylation of SFRPs and APC genes in ovarian cancer infected with high risk human papillomavirus.
24695522 2014 Association of genetic variants in Wnt signaling pathway with tuberculosis in Chinese Han population.
24643460 2014 Secreted frizzled related protein 1 modulates taxane resistance of human lung adenocarcinoma.
24625818 2014 MiR-27a targets sFRP1 in hFOB cells to regulate proliferation, apoptosis and differentiation.
24594839 2014 The Wnt antagonist sFRP1 as a favorable prognosticator in human biliary tract carcinoma.
24504368 2014 Genistein downregulates onco-miR-1260b and upregulates sFRP1 and Smad4 via demethylation and histone modification in prostate cancer cells.
24454902 2014 Tumor-specific hypermethylation of epigenetic biomarkers, including SFRP1, predicts for poorer survival in patients from the TCGA Kidney Renal Clear Cell Carcinoma (KIRC) project.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24386373 2013 WNT signaling pathway gene polymorphisms and risk of hepatic fibrosis and inflammation in HCV-infected patients.
24374650 2014 Epigenetic silencing of SFRP1 and SFRP5 by hepatitis B virus X protein enhances hepatoma cell tumorigenicity through Wnt signaling pathway.
24305703 2014 MiR-328 promotes glioma cell invasion via SFRP1-dependent Wnt-signaling activation.
24133576 2013 Role of two single nucleotide polymorphisms in secreted frizzled related protein 1 and bladder cancer risk.
24127655 2013 Epigallocatechin-3-gallate inhibits hepatoblastoma growth by reactivating the Wnt inhibitor SFRP1.
24096618 2013 AKT1E17K mutations cluster with meningothelial and transitional meningiomas and can be detected by SFRP1 immunohistochemistry.
24080158 2014 Secreted Frizzled-related protein potentiation versus inhibition of Wnt3a/?-catenin signaling.
23927957 2013 High levels of secreted frizzled-related protein 1 correlate with poor prognosis and promote tumourigenesis in gastric cancer.
23802127 2013 sFRP1 inhibits epithelial-mesenchymal transition in A549 human lung adenocarcinoma cell line.
23770846 2014 Hepatitis C virus core protein epigenetically silences SFRP1 and enhances HCC aggressiveness by inducing epithelial-mesenchymal transition.
23698475 2014 The Wnt antagonists DKK1 and SFRP1 are downregulated by promoter hypermethylation in systemic sclerosis.
23572277 2013 Expression of secreted frizzled-related protein 1 and 3, T-cell factor 1 and lymphoid enhancer factor 1 in clear cell renal cell carcinoma.
23467623 2013 Low methylation levels of the SFRP1 gene are associated with the basal-like subtype of breast cancer.
23449484 2013 Increased expression of secreted frizzled-related protein-1 and microtubule-associated protein light chain 3 in keratoconus.
23441124 2013 Tear levels of SFRP1 are significantly reduced in keratoconus patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23215838 2013 Frequent concomitant epigenetic silencing of SOX1 and secreted frizzled-related proteins (SFRPs) in human hepatocellular carcinoma.
23159077 2012 [Effects of 5-Aza-2-deoxycytidine on DNA methylation of anti-oncogenes in non-small cell lung cancer cells].
22927647 2012 Wnt antagonist SFRP1 functions as a secreted mediator of senescence.
22576962 2012 Gremlin 1, frizzled-related protein, and Dkk-1 are key regulators of human articular cartilage homeostasis.
22351518 2012 Epigenetic silencing of sFRP1 activates the canonical Wnt pathway and contributes to increased cell growth and proliferation in hepatocellular carcinoma.
22296502 2012 Epigenetic inactivation of the canonical Wnt antagonist secreted frizzled-related protein 1 in hepatocellular carcinoma cells.
22246241 2012 Change in gene expression profiles of secreted frizzled-related proteins (SFRPs) by sodium butyrate in gastric cancers: induction of promoter demethylation and histone modification causing inhibition of Wnt signaling.
22178351 2012 Association study of common variants in the sFRP1 gene region and parameters of bone strength and body composition in two independent healthy Caucasian male cohorts.
22031861 2011 Secreted-frizzled related protein 1 is a transcriptional repression target of the t(8;21) fusion protein in acute myeloid leukemia.
21830441 Decreased expression and aberrant hypermethylation of the SFRP genes in human gastric cancer.
21567192 2011 Epigenetic inactivation of the SFRP1 gene in esophageal squamous cell carcinoma.
21402050 2011 sFRP-1 binds via its netrin-related motif to the N-module of thrombospondin-1 and blocks thrombospondin-1 stimulation of MDA-MB-231 breast carcinoma cell adhesion and migration.
21344486 2011 Expression profile of WNT molecules in prostate cancer and its regulation by aminobisphosphonates.
21046672 2010 Involvement of genetic instability in the downregulation of sFRP1 in Chinese patients with hepatocellular carcinoma.
20856206 2011 Blocking Wnt signaling by SFRP-like molecules inhibits in vivo cell proliferation and tumor growth in cells carrying active ?-catenin.
20848536 2011 Expression profiling of Wnt family of genes in normal and inflammatory bowel disease primary human intestinal myofibroblasts and normal human colonic crypt epithelial cells.
20823417 2011 Medulloblastoma comprises four distinct molecular variants.
20811686 2010 WNT pathway in oral cancer: epigenetic inactivation of WNT-inhibitors.
20685720 2010 Differential expression profiling analyses identifies downregulation of 1p, 6q, and 14q genes and overexpression of 6p histone cluster 1 genes as markers of recurrence in meningiomas.
20596629 2010 Aberrant promoter methylation of WIF-1 and SFRP1, 2, 4 genes in mesothelioma.
20595636 2010 The divergent roles of secreted frizzled related protein-1 (SFRP1) in lung morphogenesis and emphysema.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20471677 2010 Transcriptional down-regulation of the Wnt antagonist SFRP1 in haematopoietic cells of patients with different risk types of MDS.
20353273 2010 Transcriptional inactivation of secreted frizzled-related protein 1 by promoter hypermethylation as a potential biomarker for non-small cell lung cancer.
20234818 2010 Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1.
20208569 2010 The SFRP family of WNT inhibitors function as novel tumor suppressor genes epigenetically silenced in medulloblastoma.
20162454 2010 Loss of SFRP1 expression is associated with aberrant beta-catenin distribution and tumor progression in mucoepidermoid carcinoma of salivary glands.
20030932 2009 [Methylation status of CpG islands in secreted frizzled-related protein gene promoter region of malignant hematopoietic cell lines].
19778523 2009 Wnt modulators, SFRP-1, and SFRP-2 are expressed in osteoblasts and differentially regulate hematopoietic stem cells.
19737074 2010 The effects of Wnt inhibitors on the chondrogenesis of human mesenchymal stem cells.
19734317 2009 Mesenchymal stem cells produce Wnt isoforms and TGF-beta1 that mediate proliferation and procollagen expression by lung fibroblasts.
19730886 2010 SFRP4 was overexpressed in colorectal carcinoma.
19723665 2009 Functional significance of secreted Frizzled-related protein 1 in metastatic renal cell carcinomas.
19702942 2009 Association of single nucleotide polymorphisms in secreted frizzled-related protein 1 gene with bone mineral density in Japanese women.
19690140 2009 Blockade of Wnt signaling inhibits angiogenesis and tumor growth in hepatocellular carcinoma.
19569235 2009 Methylation-associated silencing of SFRP1 with an 8p11-12 amplification inhibits canonical and non-canonical WNT pathways in breast cancers.
19565266 2009 Hypermethylated SFRP1, but none of other nine genes "informative" for western countries, is valuable for bladder cancer detection in Mainland China.
19543515 2009 Differential methylation pattern of ID4, SFRP1, and SHP1 between acute myeloid leukemia and chronic myeloid leukemia.
19473496 2009 WNT signaling enhances breast cancer cell motility and blockade of the WNT pathway by sFRP1 suppresses MDA-MB-231 xenograft growth.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19299079 2009 Epigenetic dysregulation of secreted Frizzled-related proteins in multiple myeloma.
19277043 2009 Secreted Frizzled-related protein-1 is a negative regulator of androgen receptor activity in prostate cancer.
19254787 2009 A small molecule inhibitor of the Wnt antagonist secreted frizzled-related protein-1 stimulates bone formation.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19118898 2009 sFRP1 promoter methylation is associated with persistent Philadelphia chromosome in chronic myeloid leukemia.
19095296 2009 SFRP1 and SFRP2 suppress the transformation and invasion abilities of cervical cancer cells through Wnt signal pathway.
19072540 2009 Modulation of Wnt signaling through inhibition of secreted frizzled-related protein I (sFRP-1) with N-substituted piperidinyl diphenylsulfonyl sulfonamides.
19053830 2008 Identification of diarylsulfone sulfonamides as secreted frizzled related protein-1 (sFRP-1) inhibitors.
18949430 2008 Methylation-associated silencing of SFRP1 in renal cell carcinoma.
18941195 2008 Soluble frizzled-related protein 1 is estrogen inducible in bone marrow stromal cells and suppresses the earliest events in lymphopoiesis.
18795670 Silencing of secreted frizzled-related protein genes in MSI colorectal carcinogenesis.
18787224 2008 Constitutive activation of the Wnt canonical pathway in mantle cell lymphoma.
18774388 2008 Genetic variation in immune signaling genes differentially expressed in asthmatic lung tissues.
18706212 2008 Aberrant expression of Wnt antagonist SFRP1 in pancreatic cancer.
18639284 2008 Identification of novel epigenetic markers for clear cell renal cell carcinoma.
18592156 2008 Frequent epigenetic inactivation of SFRP genes in hepatocellular carcinoma.
18528941 2008 Hypermethylation and aberrant expression of secreted frizzled-related protein genes in pancreatic cancer.
18497987 2008 Epigenetic inactivation of SFRP genes in oral squamous cell carcinoma.
18371946 2008 Secreted frizzled related protein 1 is a paracrine modulator of epithelial branching morphogenesis, proliferation, and secretory gene expression in the prostate.
18274669 2008 Increased expression of the WNT antagonist sFRP-1 in glaucoma elevates intraocular pressure.
18156211 2008 Regulation of endothelial cell cytoskeletal reorganization by a secreted frizzled-related protein-1 and frizzled 4- and frizzled 7-dependent pathway: role in neovessel formation.
18035687 2005 [Epigenetic inactivation of the WNT antagonist SFRP1 in breast cancer].
17994217 2008 Regulation of insulin secretion, glucokinase gene transcription and beta cell proliferation by adipocyte-derived Wnt signalling molecules.
17699851 2007 Secreted frizzled-related protein 1 loss contributes to tumor phenotype of clear cell renal cell carcinoma.
17626620 2007 Down-regulation of SFRP1 as a putative tumor suppressor gene can contribute to human hepatocellular carcinoma.
17544413 2007 Wnt signaling enhances the activation and survival of human hepatic stellate cells.
17500071 2007 Regulation of secreted Frizzled-related protein-1 by heparin.
17485441 2007 c-Myc transforms human mammary epithelial cells through repression of the Wnt inhibitors DKK1 and SFRP1.
17471511 2007 Structure-function analysis of secreted frizzled-related protein-1 for its Wnt antagonist function.
17465504 2007 Hypermethylation and aberrant expression of Wnt antagonist secreted frizzled-related protein 1 in gastric cancer.
17462603 2007 Wnt3a binds to several sFRPs in the nanomolar range.
17443492 2007 SFRP1 suppressed hepatoma cells growth through Wnt canonical signaling pathway.
17353908 2007 Frequent loss of SFRP1 expression in multiple human solid tumours: association with aberrant promoter methylation in renal cell carcinoma.
17035233 2006 Suppressing Wnt signaling by the hedgehog pathway through sFRP-1.
16775427 2006 DNA methylation alterations in urothelial carcinoma.
16609023 2006 Combination analysis of hypermethylated Wnt-antagonist family genes as a novel epigenetic biomarker panel for bladder cancer detection.
16532032 2006 Repressor roles for TCF-4 and Sfrp1 in Wnt signaling in breast cancer.
16523202 2006 The Wnt antagonist sFRP1 is downregulated in premalignant large bowel adenomas.
16449975 2006 Aberrant methylation of the Wnt antagonist SFRP1 in breast cancer is associated with unfavourable prognosis.
16423993 2006 CpG island methylation and expression of the secreted frizzled-related protein gene family in chronic lymphocytic leukemia.
16410723 2006 Epigenetic suppression of secreted frizzled related protein 1 (SFRP1) expression in human breast cancer.
16410684 2005 The transcripts of SFRP1,CEP63 and EIF4G2 genes are frequently downregulated in transitional cell carcinomas of the bladder.
16407829 2006 Alterations of the Wnt signaling pathway during the neoplastic progression of Barrett's esophagus.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16328026 2006 WNT antagonist, SFRP1, is Hedgehog signaling target.
16288033 2005 Identification of SFRP1 as a candidate mediator of stromal-to-epithelial signaling in prostate cancer.
16149501 2005 [Neurotensin].
16149051 2005 The Wnt antagonist secreted frizzled-related protein-1 controls osteoblast and osteocyte apoptosis.
16007200 2005 Transcriptional silencing of secreted frizzled related protein 1 (SFRP 1) by promoter hypermethylation in non-small-cell lung cancer.
15886250 2005 Gene expression profiling of orbital adipose tissue from patients with Graves' ophthalmopathy: a potential role for secreted frizzled-related protein-1 in orbital adipogenesis.
15677765 2005 Secreted frizzled-related protein 1 modulates glucocorticoid attenuation of osteogenic activities and bone mass.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15335268 2004 Distinct secreted Frizzled receptor protein 1 staining pattern in patients with hyperplastic polyposis coli syndrome.
15235574 2004 Evaluation of SFRP1 as a candidate for human retinal dystrophies.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14871816 2004 The Wnt antagonist sFRP1 in colorectal tumorigenesis.
14581477 2004 Secreted frizzled-related protein 1 (SFRP1) protects fibroblasts from ceramide-induced apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12413893 2002 Human secreted frizzled-related protein is down-regulated and induces apoptosis in human cervical cancer.
12055200 2002 Regulation of Wnt signaling during adipogenesis.
11932307 2002 Secreted frizzled related protein 1 is overexpressed in uterine leiomyomas, associated with a high estrogenic environment and unrelated to proliferative activity.
11741940 2002 Disulfide bond assignments of secreted Frizzled-related protein-1 provide insights about Frizzled homology and netrin modules.
11593386 2001 WNT pathway and mammary carcinogenesis: loss of expression of candidate tumor suppressor gene SFRP1 in most invasive carcinomas except of the medullary type.
10980594 2000 Secreted Frizzled-related proteins inhibit motility and promote growth of human malignant glioma cells.
10660608 2000 Secreted frizzled-related protein-1 binds directly to Wingless and is a biphasic modulator of Wnt signaling.
10347172 1999 Interaction of frizzled related protein (FRP) with Wnt ligands and the frizzled receptor suggests alternative mechanisms for FRP inhibition of Wnt signaling.
9724099 1998 Up-regulation of human secreted frizzled homolog in apoptosis and its down-regulation in breast tumors.
9391078 1997 SARPs: a family of secreted apoptosis-related proteins.
9192640 1997 Purification and molecular cloning of a secreted, Frizzled-related antagonist of Wnt action.
9096311 1997 A family of secreted proteins contains homology to the cysteine-rich ligand-binding domain of frizzled receptors.
1927703 1991 Urinary tract infection in infancy and childhood.