Property Summary

NCBI Gene PubMed Count 88
PubMed Score 31.43
PubTator Score 88.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (47)

PMID Text
26274027 PSF/SFPQ is a very common gene fusion partner in TFE3 rearrangement-associated perivascular epithelioid cell tumors (PEComas) and melanotic Xp11 translocation renal cancers.
26261210 The data suggest a model in which TRAP150 interacts with dimeric PSF to block access of RNA to RRM2, thereby regulating the activity of PSF toward a broad set of splicing events in T cells.
25765647 coiled-coil interaction motif thus provides a molecular explanation for the functional aggregation of SFPQ that directs its role in regulating many aspects of cellular nucleic acid metabolism
25605962 The ability of the SFPQ/NONO complex to form varying protein assemblies, in conjunction with the effect of post-translational modifications of SFPQ modulating mRNA binding, suggests key roles affecting mRNP dynamics within the cell.
25025966 MALAT1 binds to SFPQ releasing PTBP2 from the SFPQ/PTBP2 complex, the increased SFPQ-detached PTBP2 promotes cell proliferation and migration in colorectal cancer.
24507715 NEAT1 plays an important role in the innate immune response through the transcriptional regulation of antiviral genes by the stimulus-responsive cooperative action of NEAT1 and SFPQ.
24288667 The results of this study identify a new physiological role for the PSF-LC3B axis as a potential endogenous modulator of colon cancer treatment.
23618401 Results suggest that Llme23 can function as an oncogenic RNA and directly associate the polypyrimidine tract-binding (PTB) protein-associated splicing factor (PSF)-binding lncRNA with melanoma.
23516550 the effects of PSF on cell proliferation, tumor growth, and cell signaling associated with PPARgamma
23158102 PSF and MATR3 are cellular host factors that bind viral RNA and promote Rev activity.
23158102 Association of PSF with MATR3 is involved in nuclear retention of unspliced HIV-1 RNA and Rev activity
23131771 Partial knockdown of Annexin A2 and PSF showed decrease in p53 IRES activity and reduced levels of both the p53 isoforms.
23125841 Association of PSF with MATR3 is involved in nuclear retention of unspliced HIV-1 RNA and Rev activity
22558197 In Alzheimer's disease, Pick's disease, and Frontotemporal Lobar Degeneration Tau-mediates nuclear depletion and cytoplasmic accumulation of SFPQ.
22213094 Localisation of TopBP1 at DNA damage sites was noticed as early as 5 s following damage induction, whereas p54(nrb) and PSF localised there after 20 s.
22174317 Association of PSF with MATR3 is involved in nuclear retention of unspliced HIV-1 RNA and Rev activity
22156371 The results suggested that PSF may function as an activator for the meiosis-specific recombinase DMC1.
22114566 results indicate that SFPQ/PSF is a host factor essential for influenza virus transcription that increases the efficiency of viral mRNA polyadenylation
21881826 Data reveal a new player in tau exon 10 alternative splicing regulation and uncover a previously unknown mechanism of PSF in regulating tau pre-mRNA splicing.
21566083 RVxF motifs play an important role in controlling the multifunctional properties of p54nrb and PSF in the regulation of gene transcription
21144806 PSF influences repair via direct, local, interaction with the DNA substrate
21106524 these results identify PSF as a repressor of STAT6-mediated transcription that functions through recruitment of HDAC to the STAT6 transcription complex, and delineates a novel regulatory mechanism of IL-4 signaling
20932480 GSK3/TRAP150, complex regulates CD45 alternative splicing and demonstrate a paradigm for signal transduction from the cell surface to the RNA processing machinery through the multifunctional protein PSF.
20605917 In response to hyperosmotic stress, p38 also regulates formation of complexes between hDlg and PSF.
20421735 SFPQ/NONO heterodimer is involved in the early stage of the DSB response.
19874820 PSF (polypyrimidine tract-binding protein-associated splicing factor) and p54(nrb), two highly related proteins involved in transcription and RNA processing, are identified as new binding partners of hnRNP M.
19812236 Disruption of the growth hormone receptor polypyrimidine tract causes aberrant mRNA splicing resulting in growth hormone insensitivity.
19809274 Melanotic Xp11 translocation renal cancer: a case with PSF-TFE3 gene fusion and up-regulation of melanogenetic transcripts.
19447914 results suggest that PSF may have dual functions in homologous recombination and RNA processing through its N-terminal and central regions, respectively.
19339282 These findings are suggestive of a role for myometrial PSF as a nuclear co-regulator in the regulation of specific hormone receptor genes and their target hormone response genes.
18655028 Co-expression of PSF relocates oncogenic RING finger protein 43 (RNF43) from the nuclear periphery to the nucleoplasm.
18445785 TFII-I, PARP1, and SFPQ proteins, each previously implicated in gene regulation, form a complex controlling transcription of DYX1C1. Allelic differences in the promoter or 5'UTR of DYX1C1 may affect factor binding and thus regulation of the gene.
17965020 Findings suggest that the PSF.p54nrb complex is a novel MAP kinase signal-integrating kinases substrate that binds the mRNA for tumor necrosis factor alpha.
17639083 XRN2 associates with p54nrb/NonO(p54)-protein-associated splicing factor (PSF), multifunctional proteins involved in several nuclear processes.
17537995 identify PSF as a novel nucleophosmin 1/anaplastic lymphoma kinase-binding protein and substrate
17507659 Identification of PSF, p54(nrb), PTB, and U1A as proteins specifically bound to the COX-2 polyadenylation signal upstream sequence elements .
17452459 These data demonstrated that PSF and p54nrb complex with AR and play a key role in modulating AR-mediated gene transcription.
17318576 These results suggest that IbeA interacts with polypyrimidine tract-binding protein (PTB)-associated splicing factor (PSF) for the E. coli K1 invasion of HBMEC.[IbeA]
16938326 Mass spectrometric analysis of the complex revealed the polypyrimidine tract-binding protein-associated splicing factor (PSF) as a novel Hepatitis Delta virus RNA-interacting protein.
16832349 Expression of PSF-TFE3 in renal epithelial cells plays an important role in the initiation and maintenance of oncogenic phenotype in papillary renal cell carcinomas
16731528 DJ-1 transcriptionally up-regulates the human tyrosine hydroxylase by inhibiting the sumoylation of pyrimidine tract-binding protein-associated splicing factor
16024807 recruitment of PSF to activated promoters and the carboxyl-terminal domain of RNA polymerase II provides a mechanism by which transcription and pre-mRNA processing are coordinated within the cell.
15668243 Data suggest that polypyrimidine tract-binding protein-associated splicing factor acts as a progesterone receptor corepressor and contributes to the functional withdrawal of progesterone and the initiation of human labor.
15590677 The PSF.p54(nrb) complex cooperates with Ku protein to form a functional preligation complex with substrate DNA
12944487 p54nrb and PSF have properties of key factors mediating INS function and likely define a novel mRNA regulatory pathway that is hijacked by HIV-1.
12417296 Review article of PSF as a multi-functional nuclear protein.
12403470 Here we show that PSF interacts with p54nrb.PSF bind U5 snRNA with both the sequence and structure of stem 1b contributing to binding specificity.

AA Sequence

MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQQ      1 - 70
QPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSAPPASSSAPPATPPTSG     71 - 140
APPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQAGGPPPPPAAVPGPGPGPKQGPGPGGPKGG    141 - 210
KMPGGPKPGGGPGLSTPGGHPKPPHRGGGEPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKA    211 - 280
NLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKA    281 - 350
ELDDTPMRGRQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFAS    351 - 420
KPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEY    421 - 490
SQRWKSLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLMRRQEELRRMEELHNQEMQKR    491 - 560
KEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQK    561 - 630
FPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEG    631 - 700
PNKKPRF                                                                   701 - 707
//

Text Mined References (104)

PMID Year Title
26274027 2015 PSF/SFPQ is a very common gene fusion partner in TFE3 rearrangement-associated perivascular epithelioid cell tumors (PEComas) and melanotic Xp11 translocation renal cancers: clinicopathologic, immunohistochemical, and molecular characteristics suggesting classification as a distinct entity.
26261210 2015 TRAP150 interacts with the RNA-binding domain of PSF and antagonizes splicing of numerous PSF-target genes in T cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25765647 2015 The structure of human SFPQ reveals a coiled-coil mediated polymer essential for functional aggregation in gene regulation.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25605962 2015 Arginine methylation and citrullination of splicing factor proline- and glutamine-rich (SFPQ/PSF) regulates its association with mRNA.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25025966 2014 Long non-coding RNA MALAT1 promotes tumour growth and metastasis in colorectal cancer through binding to SFPQ and releasing oncogene PTBP2 from SFPQ/PTBP2 complex.
24507715 2014 Long noncoding RNA NEAT1-dependent SFPQ relocation from promoter region to paraspeckle mediates IL8 expression upon immune stimuli.
24288667 2013 PSF knockdown enhances apoptosis via downregulation of LC3B in human colon cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23714182 2013 Transcription of the human microsomal epoxide hydrolase gene (EPHX1) is regulated by an HNF-4?/CAR/RXR/PSF complex.
23618401 2013 The non-coding RNA llme23 drives the malignant property of human melanoma cells.
23516550 2013 PTB-associated splicing factor (PSF) is a PPAR?-binding protein and growth regulator of colon cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23158102 2013 HIV-1 pre-mRNA commitment to Rev mediated export through PSF and Matrin 3.
23131771 2012 Annexin A2 and PSF proteins interact with p53 IRES and regulate translation of p53 mRNA.
22783022 2012 The Sin3a repressor complex is a master regulator of STAT transcriptional activity.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22558197 2012 Tau-mediated nuclear depletion and cytoplasmic accumulation of SFPQ in Alzheimer's and Pick's disease.
22213094 2012 Proteomic identification of PSF and p54(nrb) as TopBP1-interacting proteins.
22156371 2012 Human PSF concentrates DNA and stimulates duplex capture in DMC1-mediated homologous pairing.
22114566 2011 The splicing factor proline-glutamine rich (SFPQ/PSF) is involved in influenza virus transcription.
21881826 2011 PSF suppresses tau exon 10 inclusion by interacting with a stem-loop structure downstream of exon 10.
21566083 2011 Consensus PP1 binding motifs regulate transcriptional corepression and alternative RNA splicing activities of the steroid receptor coregulators, p54nrb and PSF.
21499250 2011 Genome-wide association study identifies a common variant associated with risk of endometrial cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21144806 2011 Sequences in PSF/SFPQ mediate radioresistance and recruitment of PSF/SFPQ-containing complexes to DNA damage sites in human cells.
21106524 2011 PTB-associated splicing factor (PSF) functions as a repressor of STAT6-mediated Ig epsilon gene transcription by recruitment of HDAC1.
20932480 2010 Phosphorylation-dependent regulation of PSF by GSK3 controls CD45 alternative splicing.
20813759 2011 The splicing-factor related protein SFPQ/PSF interacts with RAD51D and is necessary for homology-directed repair and sister chromatid cohesion.
20605917 2010 p38gamma regulates interaction of nuclear PSF and RNA with the tumour-suppressor hDlg in response to osmotic shock.
20454556 2010 Secreted Mycobacterium tuberculosis Rv3654c and Rv3655c proteins participate in the suppression of macrophage apoptosis.
20421735 2010 Involvement of Matrin 3 and SFPQ/NONO in the DNA damage response.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19874820 2010 hnRNP M interacts with PSF and p54(nrb) and co-localizes within defined nuclear structures.
19812236 2010 Identification and characterisation of a novel GHR defect disrupting the polypyrimidine tract and resulting in GH insensitivity.
19809274 2009 Melanotic Xp11 translocation renal cancer: a case with PSF-TFE3 gene fusion and up-regulation of melanogenetic transcripts.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19447914 2009 Human PSF binds to RAD51 and modulates its homologous-pairing and strand-exchange activities.
19439179 2009 BRK phosphorylates PSF promoting its cytoplasmic localization and cell cycle arrest.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19339282 2009 Interplay between polypyrimidine tract binding protein-associated splicing factor and human myometrial progesterone receptors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18655028 2008 Proteomic identification of a PSF/p54nrb heterodimer as RNF43 oncoprotein-interacting proteins.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
18445785 2008 The complex of TFII-I, PARP1, and SFPQ proteins regulates the DYX1C1 gene implicated in neuronal migration and dyslexia.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17965020 2008 The PSF.p54nrb complex is a novel Mnk substrate that binds the mRNA for tumor necrosis factor alpha.
17639083 2007 The multifunctional protein p54nrb/PSF recruits the exonuclease XRN2 to facilitate pre-mRNA 3' processing and transcription termination.
17537995 2007 NPM/ALK binds and phosphorylates the RNA/DNA-binding protein PSF in anaplastic large-cell lymphoma.
17507659 2007 Specific trans-acting proteins interact with auxiliary RNA polyadenylation elements in the COX-2 3'-UTR.
17452459 2007 Transcriptional activity of androgen receptor is modulated by two RNA splicing factors, PSF and p54nrb.
17318576 2007 PSF is an IbeA-binding protein contributing to meningitic Escherichia coli K1 invasion of human brain microvascular endothelial cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16938326 2006 Binding of the polypyrimidine tract-binding protein-associated splicing factor (PSF) to the hepatitis delta virus RNA.
16832349 2007 Role of PSF-TFE3 oncoprotein in the development of papillary renal cell carcinomas.
16731528 2006 DJ-1 transcriptionally up-regulates the human tyrosine hydroxylase by inhibiting the sumoylation of pyrimidine tract-binding protein-associated splicing factor.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16417406 2006 Hem-1 complexes are essential for Rac activation, actin polymerization, and myosin regulation during neutrophil chemotaxis.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16024807 2005 Role for PSF in mediating transcriptional activator-dependent stimulation of pre-mRNA processing in vivo.
15975576 2005 Mass spectroscopy identifies the splicing-associated proteins, PSF, hnRNP H3, hnRNP A2/B1, and TLS/FUS as interacting partners of the ZNF198 protein associated with rearrangement in myeloproliferative disease.
15790595 2005 The Parkinson's disease-associated DJ-1 protein is a transcriptional co-activator that protects against neuronal apoptosis.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15668243 2005 Identification and characterization of the protein-associated splicing factor as a negative co-regulator of the progesterone receptor.
15635413 2005 Nucleolar proteome dynamics.
15590677 2005 Identification of the polypyrimidine tract binding protein-associated splicing factor.p54(nrb) complex as a candidate DNA double-strand break rejoining factor.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231747 2004 A protein interaction framework for human mRNA degradation.
15140795 2004 Expression and functional significance of mouse paraspeckle protein 1 on spermatogenesis.
15105431 2004 Recognition sequences for the GYF domain reveal a possible spliceosomal function of CD2BP2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12944487 2003 PSF acts through the human immunodeficiency virus type 1 mRNA instability elements to regulate virus expression.
12840015 2003 Nuclear coactivator-62 kDa/Ski-interacting protein is a nuclear matrix-associated coactivator that may couple vitamin D receptor-mediated transcription and RNA splicing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417296 2002 PSF and p54(nrb)/NonO--multi-functional nuclear proteins.
12403470 2002 PSF and p54nrb bind a conserved stem in U5 snRNA.
11897684 2002 Transcriptional activation of human CYP17 in H295R adrenocortical cells depends on complex formation among p54(nrb)/NonO, protein-associated splicing factor, and SF-1, a complex that also participates in repression of transcription.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11525732 2001 The fate of dsRNA in the nucleus: a p54(nrb)-containing complex mediates the nuclear retention of promiscuously A-to-I edited RNAs.
11514619 2001 Nuclear relocalization of the pre-mRNA splicing factor PSF during apoptosis involves hyperphosphorylation, masking of antigenic epitopes, and changes in protein interactions.
11259580 2001 PSF is a novel corepressor that mediates its effect through Sin3A and the DNA binding domain of nuclear hormone receptors.
11161712 2001 An RNA recognition motif (RRM) is required for the localization of PTB-associated splicing factor (PSF) to subnuclear speckles.
11060040 2000 Human pre-mRNA cleavage factor II(m) contains homologs of yeast proteins and bridges two other cleavage factors.
10931916 2000 Human 100-kDa homologous DNA-pairing protein is the splicing factor PSF and promotes DNA strand invasion.
10858305 2000 PSF/p54(nrb) stimulates "jumping" of DNA topoisomerase I between separate DNA helices.
10847580 2000 Polypyrimidine tract-binding protein-associated splicing factor is a negative regulator of transcriptional activity of the porcine p450scc insulin-like growth factor response element.
10653975 2000 Differential nuclear localization and nuclear matrix association of the splicing factors PSF and PTB.
9848648 1998 The snRNP-free U1A (SF-A) complex(es): identification of the largest subunit as PSF, the polypyrimidine-tract binding protein-associated splicing factor.
9756848 1998 The RNA-splicing factor PSF/p54 controls DNA-topoisomerase I activity by a direct interaction.
9409622 1997 The human U5 snRNP-specific 100-kD protein is an RS domain-containing, putative RNA helicase with significant homology to the yeast splicing factor Prp28p.
9393982 1997 Fusion of splicing factor genes PSF and NonO (p54nrb) to the TFE3 gene in papillary renal cell carcinoma.
8766827 1996 Interaction of protein phosphatase type 1 with a splicing factor.
8449401 1993 Cloning and characterization of PSF, a novel pre-mRNA splicing factor.
8439294 1993 Purification and characterization of a DNA-binding heterodimer of 52 and 100 kDa from HeLa cells.
8045264 1994 A novel set of spliceosome-associated proteins and the essential splicing factor PSF bind stably to pre-mRNA prior to catalytic step II of the splicing reaction.
2480877 1989 Cloning and characterization of a myoblast cell surface antigen defined by 24.1D5 monoclonal antibody.