Property Summary

NCBI Gene PubMed Count 171
PubMed Score 391.25
PubTator Score 175.69

Knowledge Summary


No data available


  Disease (4)


  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.200 8.5e-03
atypical teratoid / rhabdoid tumor 1.900 5.0e-04
Breast cancer 2.300 4.2e-02
cystic fibrosis -1.584 9.6e-06
diabetes mellitus 1.100 1.2e-03
ductal carcinoma in situ 1.700 1.4e-02
ependymoma 1.300 1.2e-05
interstitial cystitis -1.400 1.9e-02
intraductal papillary-mucinous adenoma (... 3.400 5.3e-03
intraductal papillary-mucinous carcinoma... 3.400 7.5e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.4e-02
lung adenocarcinoma 1.400 1.5e-10
lung cancer 3.100 2.1e-05
malignant mesothelioma 1.300 3.5e-05
medulloblastoma, large-cell 1.400 1.0e-04
non-small cell lung cancer 2.112 7.6e-11
osteosarcoma 1.013 2.2e-05
ovarian cancer 1.300 1.3e-02
pancreatic cancer 2.000 5.3e-07
pancreatic ductal adenocarcinoma liver m... 2.124 3.5e-02
psoriasis 1.600 9.5e-05
sarcoidosis -1.300 1.2e-02
spina bifida -1.210 3.7e-02

Protein-protein Interaction (6)

Gene RIF (113)

AA Sequence

DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS                                    211 - 248

Text Mined References (178)

PMID Year Title