Property Summary

NCBI Gene PubMed Count 16
PubMed Score 100.94
PubTator Score 52.21

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
chronic lymphocytic leukemia 1.440 9.0e-05
malignant mesothelioma 2.200 7.8e-08
psoriasis 1.500 1.6e-03
osteosarcoma -2.114 8.6e-09
tuberculosis -1.300 2.6e-06
group 3 medulloblastoma 1.100 1.1e-03
ovarian cancer 1.100 7.3e-06

Gene RIF (7)

PMID Text
23928305 The malignant brain tumor (MBT) domain protein SFMBT1 is an integral histone reader subunit of the LSD1 demethylase complex for chromatin association and epithelial-to-mesenchymal transition.
23898208 HIV-1 Tat downregulates the expression of Scm-like with four mbt domains 1 (SFMBT1) in human primary T cells
23592795 When bound to its gene targets, SFMBT1 recruits its associated proteins and causes chromatin compaction and transcriptional repression
23349461 novel mechanisms accounting for SFMBT1-mediated transcription repression and revealed an essential role of Sfmbt1 in regulating MyoD-mediated transcriptional silencing
22479346 Data identified IGF1, SLC4A4, WWOX, and SFMBT1 as hypertension susceptibility genes by gene based association scan and gene expression analysis.
21325761 A segmental copy number loss of the SFMBT1 gene may be involved in the pathological process in some individuals with ventriculomegaly/idiopathic normal pressure hydrocephalus.
17599839 The tandem MBT repeats form a functional structure required for biological activity of hSFMBT and predict similar properties for other MBT domain-containing proteins.

AA Sequence

MNGEQQLDADAGSGMEEVELSWEDYLEETGSTAVPYGSFKHVDTRLQNGFAPGMKLEVAVRTDPETYWVA      1 - 70
TVITTCEQLLLLRYDGYGEDRRADFWCDIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIG     71 - 140
ACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLY    141 - 210
YLDPFLHHVGWAAQQGYELQPPSAIRHLKNEAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMK    211 - 280
LEAVDPWSPFGISPATVVKVFDEKYFLVEMDDLRPENHARRSFVCHADSPGIFPVQWSLKNGLHISPPPG    281 - 350
YPSQDFDWADYLKQCGAEAAPQRCFPPLISEHEFKENMKLEAVNPILPEEVCVATITAVRGSYLWLQLEG    351 - 420
SKKPIPECIVSVESMDIFPLGWCETNGHPLSTPRRARVYKQRKIAVVQPEKQVPSSRTVHEGLRNQELNS    421 - 490
TESVMINGKYCCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQ    491 - 560
LDKDSVWHGCGEVLKAKYKGKSYRATVEIVKTADRVTEFCRQTCIKLECCPNLFGPRMVLDKCSENCSVL    561 - 630
TKTKYTHYYGKKKNKRIGRPPGGHSNLACALKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGSGGE    631 - 700
DEDDPDEGDDDSLSEGSTSEQQDELQEESEMSEKKSCSSSPTQSEISTSLPPDRQRRKRELRTFSFSDDE    701 - 770
NKPPSPKEIRIEVAERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMD    771 - 840
LKLGPAIKLCHHIERIKFAFYEQFAN                                                841 - 866
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23928305 2013 The malignant brain tumor (MBT) domain protein SFMBT1 is an integral histone reader subunit of the LSD1 demethylase complex for chromatin association and epithelial-to-mesenchymal transition.
23592795 2013 SFMBT1 functions with LSD1 to regulate expression of canonical histone genes and chromatin-related factors.
23349461 2013 Proteomic and functional analyses reveal the role of chromatin reader SFMBT1 in regulating epigenetic silencing and the myogenic gene program.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22479346 2012 Identification of IGF1, SLC4A4, WWOX, and SFMBT1 as hypertension susceptibility genes in Han Chinese with a genome-wide gene-based association study.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21325761 2011 Segmental copy number loss of SFMBT1 gene in elderly individuals with ventriculomegaly: a community-based study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17599839 2007 Human SFMBT is a transcriptional repressor protein that selectively binds the N-terminal tail of histone H3.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10661410 2000 Processing of some antigens by the standard proteasome but not by the immunoproteasome results in poor presentation by dendritic cells.