Property Summary

NCBI Gene PubMed Count 16
PubMed Score 31.51
PubTator Score 8.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.400 7.8e-04
osteosarcoma -2.123 4.3e-09
intraductal papillary-mucinous adenoma (... 1.200 7.2e-04
intraductal papillary-mucinous carcinoma... 1.200 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.600 7.1e-04
Pick disease -1.200 8.5e-05
ovarian cancer 1.100 2.3e-05

Gene RIF (2)

PMID Text
22082156 Knockdown of Sfi1 homolog, spindle assembly associated (yeast) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
19857500 The structure of C-HsCen2 [the C-terminal domain of HsCen2 (T94-Y172)] in complex with R17-hSfi1-20 was determined.

AA Sequence

MKNLLTEKCISSHNFHQKVIKQRMEKKVDSRYFKDGAVKKPYSAKTLSNKKSSASFGIRRELPSTSHLVQ      1 - 70
YRGTHTCTRQGRLRELRIRCVARKFLYLWIRMTFGRVFPSKARFYYEQRLLRKVFEEWKEEWWVFQHEWK     71 - 140
LCVRADCHYRYYLYNLMFQTWKTYVRQQQEMRNKYIRAEVHDAKQKMRQAWKSWLIYVVVRRTKLQMQTT    141 - 210
ALEFRQRIILRVWWSTWRQRLGQVRVSRALHASALKHRALSLQVQAWSQWREQLLYVQKEKQKVVSAVKH    211 - 280
HQHWQKRRFLKAWLEYLQVRRVKRQQNEMAERFHHVTVLQIYFCDWQQAWERRESLYAHHAQVEKLARKM    281 - 350
ALRRAFTHWKHYMLLCAEEAAQFEMAEEHHRHSQLYFCFRALKDNVTHAHLQQIRRNLAHQQHGVTLLHR    351 - 420
FWNLWRSQIEQKKERELLPLLHAAWDHYRIALLCKCIELWLQYTQKRRYKQLLQARADGHFQQRALPAAF    421 - 490
HTWNRLWRWRHQENVLSARATRFHRETLEKQVFSLWRQKMFQHRENRLAERMAILHAERQLLYRSWFMWH    491 - 560
QQAAARHQEQEWQTVACAHHRHGRLKKAFCLWRESAQGLRTERTGRVRAAEFHMAQLLRWAWSQWRECLA    561 - 630
LRGAERQKLMRADLHHQHSVLHRALQAWVTYQGRVRSILREVAARESQHNRQLLRGALRRWKENTMARVD    631 - 700
EAKKTFQASTHYRRTICSKVLVQWREAVSVQMYYRQQEDCAIWEAQKVLDRGCLRTWFQRWWDCSRRSAQ    701 - 770
QRLQLERAVQHHHRQLLLEGLARWKTHHLQCVRKRLLHRQSTQLLAQRLSRTCFRQWRQQLAARRQEQRA    771 - 840
TVRALWFWAFSLQAKVWATWLAFVLERRRKKARLQWALQAYQGQLLQEGATRLLRFAASMKASRQQLQAQ    841 - 910
QQVQAAHSLHRAVRRCATLWKQKVLGRGGKPQPLAAIAPSRKVTFEGPLLNRIAAGAGDGTLETKRPQAS    911 - 980
RPLGALGRLAAEEPHALELNTAHSARKQPRRPHFLLEPAQSQRPQKPQEHGLGMAQPAAPSLTRPFLAEA    981 - 1050
PTALVPHSPLPGALSSAPGPKQPPTASTGPELLLLPLSSFMPCGAAAPARVSAQRATPRDKPPVPSSLAS   1051 - 1120
VPDPHLLLPGDFSATRAGPGLSTAGSLDLEAELEEIQQQLLHYQTTKQNLWSCRRQASSLRRWLELNREE   1121 - 1190
PGPEDQEVEQQVQKELEQVEMQIQLLAEELQAQRQPIGACVARIQALRQALC                     1191 - 1242
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
19857500 2010 Structure, dynamics and thermodynamics of the human centrin 2/hSfi1 complex.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
16956364 2006 Binding of human centrin 2 to the centrosomal protein hSfi1.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14504268 2003 Sfi1p has conserved centrin-binding sites and an essential function in budding yeast spindle pole body duplication.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10591208 1999 The DNA sequence of human chromosome 22.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.