Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.54
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3098 9.8e-06
group 3 medulloblastoma 2254 2.1e-03
ovarian cancer 8491 2.1e-03

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 2.1e-03
ovarian cancer 1.400 2.1e-03
Breast cancer 1.100 9.8e-06

Protein-protein Interaction (175)

U2SURP   POLR2D   DHX15   PRPF4   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   SF3B1   WBP4   SNRNP200   BCAS2   DNAJC8   SMNDC1   PRPF6   PCF11   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SNRPB2   SNRNP70   SNRPA   SNRPC   HNRNPA1   SNRPA1   HSPA8   GTF2F2   SNRPB   HNRNPL   DDX5   POLR2C   POLR2E   HNRNPA2B1   POLR2A   U2AF2   PTBP1   POLR2B   HNRNPH1   CSTF2   GTF2F1   FUS   POLR2I   RBMX   EIF4A3   BUD31   PAPOLA   HNRNPA3   HNRNPM   POLR2H   POLR2J   HNRNPF   RBM5   POLR2K   SNU13   HNRNPH2   POLR2F   MAGOH   HNRNPK   SNRPE   SNRPF   SNRPG   LSM3   LSM6   SNRPD1   SNRPD2   SNRPD3   POLR2G   POLR2L   TRA2B   SNURF   YBX1   TXNL4A   SRSF3   HNRNPU   U2AF1   SRSF2   CSTF1   SRSF11   SRSF1   SRSF4   DHX9   CPSF1   SF3A3   ELAVL2   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   SNW1   HNRNPD   EFTUD2   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   SF1   ZRSR2   ELAVL1   SNRNP35   SRSF7   USP39   SNRNP48   PRPF8   FIP1L1   CWC27   DDX46   PHF5A   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PDCD7   PRPF38A   ZCRB1   U2AF1L4   SNRNP27   PRPF31   CTNNBL1   DHX38   PRCC   SYMPK   GPKOW   CLP1   MAGOHB   PPWD1   SNRNP40   RBM17   RNPC3   CDC5L   HNRNPUL1   DDX23   SNRNP25   SF3B5   UPF3B   CRNKL1   WDR33   CSTF2T   CWC22   XAB2   RBM22   CWC25   CWC15   CPSF2   ZMAT5   PUF60   LSM7   CPSF3   ISY1   PRPF19   PPIE   SRRM2   WBP11   LSM2   PPIL1   LSM5   LSM4   RBM8A  

Gene RIF (4)

PMID Text
26784522 the p14-RNA interaction screens charges on the backbone of the branch site during spliceosome assembly.
19773279 Observational study of gene-disease association. (HuGE Navigator)
16432215 determined the high resolution structure of a complex between SF3b14 and a peptide derived from SF3b155 and proposed a model for recognition of the pre-mRNA branch sequence adenosine.
12738865 determined the three-dimensional structure of the human SF3b complex by single-particle electron cryomicroscopy at a resolution of less than 10 angstroms, allowing identification of protein domains with known structural folds

AA Sequence

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDA      1 - 70
KNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK                    71 - 125
//

Text Mined References (26)

PMID Year Title
26784522 2016 Interaction between the Spliceosomal Pre-mRNA Branch Site and U2 snRNP Protein p14.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21062891 2011 Structural model of the p14/SF3b155 · branch duplex complex.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16432215 2006 Crystal structure of a core spliceosomal protein interface.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12738865 2003 Molecular architecture of the multiprotein splicing factor SF3b.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234937 2002 Characterization of novel SF3b and 17S U2 snRNP proteins, including a human Prp5p homologue and an SF3b DEAD-box protein.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11500380 2001 A novel U2 and U11/U12 snRNP protein that associates with the pre-mRNA branch site.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.