Property Summary

NCBI Gene PubMed Count 39
PubMed Score 27.75
PubTator Score 23.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.200 2.8e-05
ependymoma 1.300 8.3e-03
oligodendroglioma 1.300 6.9e-03
astrocytoma 1.900 1.6e-04
glioblastoma 1.200 3.3e-06
atypical teratoid / rhabdoid tumor 1.100 1.0e-05
medulloblastoma, large-cell 1.300 9.7e-06
pancreatic ductal adenocarcinoma liver m... 1.530 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.6e-03
pediatric high grade glioma 1.100 3.3e-07
ovarian cancer 2.000 1.4e-05

Gene RIF (13)

PMID Text
25731616 High SF3B4 expression is associated with hepatocellular carcinoma.
24003905 SF3B4 haploinsufficiency confirmed as the major cause of Nager syndrome.
23568615 SF3B4 mutation is associated with Nager syndrome.
23125841 Tandem affinity purification and mass spectrometry analysis identify 49kDa subunit 4 of splicing factor 3b (SF3B4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22541558 These results suggest that most cases of Nager syndrome are caused by haploinsufficiency of SF3B4.
22415777 Inhibiting the induction of two proteins involved in two of the most significantly upregulated cellular processes, ribosome biogenesis (eIF6) and hnRNA splicing (SF3B2/SF3B4), showed that human T cells can enter the cell cycle without growing in size.
20012529 Tandem affinity purification and mass spectrometry analysis identify 49kDa subunit 4 of splicing factor 3b (SF3B4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19275585 Tandem affinity purification and mass spectrometry analysis identify 49kDa subunit 4 of splicing factor 3b (SF3B4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17513295 SF3b4, known to be localized in the nucleus and involved in RNA splicing, binds BMPR-IA and specifically inhibits BMP-mediated osteochondral cell differentiation
17347016 Tandem affinity purification and mass spectrometry analysis identify 49kDa subunit 4 of splicing factor 3b (SF3B4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
16923959 Tandem affinity purification and mass spectrometry analysis identify 49kDa subunit 4 of splicing factor 3b (SF3B4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
15351706 SAP49 is regulated by the BMPR-IA tumor suppressor
12738865 determined the three-dimensional structure of the human SF3b complex by single-particle electron cryomicroscopy at a resolution of less than 10 angstroms, allowing identification of protein domains with known structural folds

AA Sequence

MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYA      1 - 70
IKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGN     71 - 140
SKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQL    141 - 210
FADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGT    211 - 280
PGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMG    281 - 350
MPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRG    351 - 420
PLPQ                                                                      421 - 424
//

Text Mined References (44)

PMID Year Title
25731616 2015 Meta-analysis of gene expression profiles indicates genes in spliceosome pathway are up-regulated in hepatocellular carcinoma (HCC).
25416956 2014 A proteome-scale map of the human interactome network.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
24003905 2014 Nager syndrome: confirmation of SF3B4 haploinsufficiency as the major cause.
23568615 2013 Clinical and mutation data in 12 patients with the clinical diagnosis of Nager syndrome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22541558 2012 Haploinsufficiency of SF3B4, a component of the pre-mRNA spliceosomal complex, causes Nager syndrome.
22415777 2012 Proteomic and protein interaction network analysis of human T lymphocytes during cell-cycle entry.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17513295 2007 Splicing factor 3b subunit 4 binds BMPR-IA and inhibits osteochondral cell differentiation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15351706 2004 Interaction of the BMPR-IA tumor suppressor with a developmentally relevant splicing factor.
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
15105431 2004 Recognition sequences for the GYF domain reveal a possible spliceosomal function of CD2BP2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12738865 2003 Molecular architecture of the multiprotein splicing factor SF3b.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234937 2002 Characterization of novel SF3b and 17S U2 snRNP proteins, including a human Prp5p homologue and an SF3b DEAD-box protein.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11500380 2001 A novel U2 and U11/U12 snRNP protein that associates with the pre-mRNA branch site.
10882114 2000 Functional association of U2 snRNP with the ATP-independent spliceosomal complex E.
10490618 1999 Characterization of a protein complex containing spliceosomal proteins SAPs 49, 130, 145, and 155.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7958871 1994 The prespliceosome components SAP 49 and SAP 145 interact in a complex implicated in tethering U2 snRNP to the branch site.