Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.75
PubTator Score 13.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.300 1.3e-03
atypical teratoid / rhabdoid tumor 1.300 1.1e-09
medulloblastoma, large-cell 1.300 9.6e-06
lung cancer 1.400 1.8e-03
colon cancer 1.200 2.5e-04
ovarian cancer 1.500 7.2e-06

 GO Function (1)

Gene RIF (3)

PMID Text
25651737 Report detection of SF3B3 gene mutations in oral cancer using high resolution melting analysis.
25431237 our findings suggest a role for the elevated expression of SF3B3 in poor prognosis and tamoxifen resistance, leading to recurrence of estrogen receptor-positive breast cancer
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRL      1 - 70
TGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKL     71 - 140
VYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTF    141 - 210
YELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDD    211 - 280
PERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVA    281 - 350
SEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDT    351 - 420
PQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGET    421 - 490
VEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTG    491 - 560
GELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSM    561 - 630
QALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVK    631 - 700
LFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKL    701 - 770
GAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAA    771 - 840
AFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVA    841 - 910
KDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRK    911 - 980
CENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKF    981 - 1050
GNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYT   1051 - 1120
TLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQ   1121 - 1190
KNVSEELDRTPPEVSKKLEDIRTRYAF                                              1191 - 1217
//

Text Mined References (33)

PMID Year Title
25651737 2014 Detection of SF3B3 gene mutations in oral cancer by high resolution melting analysis.
25431237 2015 Expression levels of SF3B3 correlate with prognosis and endocrine resistance in estrogen receptor-positive breast cancer.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974796 2013 Identification of a long non-coding RNA-associated RNP complex regulating metastasis at the translational step.
23951410 2013 Regulation of Cullin-RING ubiquitin ligase 1 by Spliceosome-associated protein 130 (SAP130).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12738865 2003 Molecular architecture of the multiprotein splicing factor SF3b.
12601814 2003 Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234937 2002 Characterization of novel SF3b and 17S U2 snRNP proteins, including a human Prp5p homologue and an SF3b DEAD-box protein.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11564863 2001 Human STAGA complex is a chromatin-acetylating transcription coactivator that interacts with pre-mRNA splicing and DNA damage-binding factors in vivo.
11500380 2001 A novel U2 and U11/U12 snRNP protein that associates with the pre-mRNA branch site.
11438666 2001 The TFIID components human TAF(II)140 and Drosophila BIP2 (TAF(II)155) are novel metazoan homologues of yeast TAF(II)47 containing a histone fold and a PHD finger.
11406595 2001 UV-damaged DNA-binding protein in the TFTC complex links DNA damage recognition to nucleosome acetylation.
10490618 1999 Characterization of a protein complex containing spliceosomal proteins SAPs 49, 130, 145, and 155.
10428969 1999 Purification and biochemical characterization of interchromatin granule clusters.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.