Property Summary

NCBI Gene PubMed Count 33
PubMed Score 19.86
PubTator Score 9.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
HIV Infections 99
Disease Target Count P-value
malignant mesothelioma 3163 4.3e-07
ovarian cancer 8491 1.5e-05
diabetes mellitus 1663 1.2e-03
astrocytoma 1493 1.9e-03

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.700 4.3e-07
astrocytoma 1.100 1.9e-03
diabetes mellitus -1.300 1.2e-03
ovarian cancer 1.700 1.5e-05

Gene RIF (4)

PMID Text
22190034 HIV-1 Rev interacting protein, splicing factor 3a, subunit 3 (SF3A3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SF3A3 is increased by RRE
22174317 HIV-1 Rev interacting protein, splicing factor 3a, subunit 3 (SF3A3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SF3A3 is increased by RRE
18713018 SF3a3 functions as a co-repressor of Constitutive Androstane Receptor transcriptional activity, in addition to its canonical function.
15647371 SF3a60, 66, and 120, but not SF1, are essential for pre-mRNA splicing

AA Sequence

METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKE      1 - 70
ELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYL     71 - 140
DLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELF    141 - 210
GKIQAEFEKKWENGTFPGWPKETSSALTHAGAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEE    211 - 280
RAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQA    281 - 350
RTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPK    351 - 420
AFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKK    421 - 490
TYEDLKRQGLL                                                               491 - 501
//

Text Mined References (45)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22190034 2011 Global landscape of HIV-human protein complexes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18713018 2008 Specific inhibition of transcriptional activity of the constitutive androstane receptor (CAR) by the splicing factor SF3a3.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17098193 2006 Solution structures of the SURP domains and the subunit-assembly mechanism within the splicing factor SF3a complex in 17S U2 snRNP.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15647371 2005 Human splicing factor SF3a, but not SF1, is essential for pre-mRNA splicing in vivo.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15316075 2004 A role for Cajal bodies in the final steps of U2 snRNP biogenesis.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12565890 2003 Centaurin-alpha 1 associates in vitro and in vivo with nucleolin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234937 2002 Characterization of novel SF3b and 17S U2 snRNP proteins, including a human Prp5p homologue and an SF3b DEAD-box protein.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11533230 2001 Domains in human splicing factors SF3a60 and SF3a66 required for binding to SF3a120, assembly of the 17S U2 snRNP, and prespliceosome formation.
11500380 2001 A novel U2 and U11/U12 snRNP protein that associates with the pre-mRNA branch site.
10882114 2000 Functional association of U2 snRNP with the ATP-independent spliceosomal complex E.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8022796 1994 Specific protein-protein interactions between the essential mammalian spliceosome-associated proteins SAP 61 and SAP 114.
7816610 1994 Splicing factor SF3a60 is the mammalian homologue of PRP9 of S.cerevisiae: the conserved zinc finger-like motif is functionally exchangeable in vivo.