1. Home
  2. Targets
  3. nucleic acid binding
  4. RNA binding protein
  5. mRNA processing factor
  6. mRNA splicing factor
  7. Splicing factor 3A subunit 2

Tbio Splicing factor 3A subunit 2

Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.

This gene encodes subunit 2 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 2 interacts with subunit 1 through its amino-terminus while the single zinc finger domain of subunit 2 plays a role in its binding to the 15S U2 snRNP. Subunit 2 may also function independently of its RNA splicing function as a microtubule-binding protein. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 31
PubMed Score 19.87
PubTator Score 12.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 6.5e-06
psoriasis -1.900 3.4e-08
sonic hedgehog group medulloblastoma 1.700 3.2e-05
astrocytoma 1.200 5.5e-03
atypical teratoid / rhabdoid tumor 1.600 8.9e-07
glioblastoma 1.600 5.3e-05
medulloblastoma, large-cell 1.900 5.3e-05
primitive neuroectodermal tumor 1.100 1.2e-03
ovarian cancer 1.600 3.1e-07
Gaucher disease type 1 1.300 1.9e-02

Synonym

Accession Q15428 B2RBU1 D6W605 O75245
Symbols PRP11
SAP62
PRPF11
SF3a66

Gene

SF3A2

PANTHER Protein Class (4)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (13)

See all...

 GO Function (2)

 GO Component (7)

 GO Process (5)

 Compartment GO Term (30)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (6)

Protein-protein Interaction (88)

U2SURP   DHX15   SART1   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   WBP4   BCAS2   SMNDC1   PCF11   CD2BP2   CPSF4   LSM8   SYF2   U2AF2   CSTF2   PAPOLA   LSM3   LSM6   TRA2B   SNURF   SRSF3   U2AF1   SRSF2   CSTF1   SRSF1   SRSF4   CPSF1   SF3A3   CSTF3   SRSF9   SRSF5   SRSF6   SF3B2   RNPS1   SF3B3   SF3B4   SF1   USP39   PRPF8   FIP1L1   CWC27   DDX46   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PRPF38A   U2AF1L4   SNRNP27   PRPF31   DHX38   CLP1   MAGOHB   PPWD1   SNRNP40   RBM17   CDC5L   HNRNPUL1   SF3B5   UPF3B   CRNKL1   CSTF2T   CWC22   RBM22   CWC25   CWC15   CPSF2   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM5   LSM4   RBM8A  

Gene RIF (4)

PMID Text
24916648 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese
22174317 HIV-1 Rev interacting protein, splicing factor 3a, subunit 2 (SF3A2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SF3A2 is increased by RRE
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15647371 SF3a60, 66, and 120, but not SF1, are essential for pre-mRNA splicing

AA Sequence 

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYL      1 - 70
AHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPE     71 - 140
IAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF    141 - 210
HFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQL    211 - 280
PPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGV    281 - 350
HPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPG    351 - 420
VHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN                              421 - 464
//

Text Mined References (34)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
24916648 2015 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese.
24304693 2014 Identification of a novel component C2ORF3 in the lariat-intron complex: lack of C2ORF3 interferes with pre-mRNA splicing via intron turnover pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17332742 2007 Composition and three-dimensional EM structure of double affinity-purified, human prespliceosomal A complexes.
15647371 2005 Human splicing factor SF3a, but not SF1, is essential for pre-mRNA splicing in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15316075 2004 A role for Cajal bodies in the final steps of U2 snRNP biogenesis.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15142036 2004 The pre-mRNA-splicing factor SF3a66 functions as a microtubule-binding and -bundling protein.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234937 2002 Characterization of novel SF3b and 17S U2 snRNP proteins, including a human Prp5p homologue and an SF3b DEAD-box protein.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11602354 2001 An expressed GNRP-like gene shares a bi-directional promoter with SF3A2 (SAP62) immediately upstream of AMH.
11533230 2001 Domains in human splicing factors SF3a60 and SF3a66 required for binding to SF3a120, assembly of the 17S U2 snRNP, and prespliceosome formation.
11500380 2001 A novel U2 and U11/U12 snRNP protein that associates with the pre-mRNA branch site.
10882114 2000 Functional association of U2 snRNP with the ATP-independent spliceosomal complex E.
10385517 1999 Combined biochemical and electron microscopic analyses reveal the architecture of the mammalian U2 snRNP.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9710584 1998 CUS2, a yeast homolog of human Tat-SF1, rescues function of misfolded U2 through an unusual RNA recognition motif.
9576861 1998 Structural/functional properties of a mammalian multi-component structure containing all major spliceosomal small nuclear ribonucleoprotein particles.
9016565 1997 Association of U2 snRNP with the spliceosomal complex E.
8718683 1996 Essential domains of the PRP21 splicing factor are implicated in the binding to PRP9 and PRP11 proteins and are conserved through evolution.
8541848 1995 The genes for a spliceosome protein (SAP62) and the anti-Müllerian hormone (AMH) are contiguous.
8211113 1993 Correspondence between a mammalian spliceosome component and an essential yeast splicing factor.