Property Summary

NCBI Gene PubMed Count 51
PubMed Score 46.93
PubTator Score 305.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.500 2.4e-02
astrocytic glioma 1.800 1.3e-02
atypical teratoid / rhabdoid tumor 2.000 1.2e-03
Breast cancer -1.100 5.8e-06
breast carcinoma -1.200 1.9e-12
ependymoma 1.900 3.7e-02
glioblastoma 1.500 1.1e-02
head and neck cancer and chronic obstruc... -1.400 6.7e-03
interstitial lung disease 1.200 2.4e-02
intraductal papillary-mucinous adenoma (... 1.400 9.4e-04
intraductal papillary-mucinous carcinoma... 1.300 4.4e-03
malignant mesothelioma 1.400 2.6e-03
medulloblastoma 1.200 7.2e-03
medulloblastoma, large-cell 1.600 4.0e-05
Multiple myeloma 1.450 8.3e-05
non-small cell lung cancer -1.168 1.4e-06
oligodendroglioma 1.700 2.6e-02
osteosarcoma -1.156 2.2e-02
ovarian cancer -2.000 1.8e-10
Pick disease 1.800 1.9e-03
primitive neuroectodermal tumor 1.200 1.8e-02
psoriasis -1.800 2.6e-05

 GWAS Trait (1)

Gene RIF (19)

AA Sequence

MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDL      1 - 70
GIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKV     71 - 140
MIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTAN    141 - 210
TMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCT    211 - 280
KCGGAGHIASDCKFQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPA    281 - 350
NNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP    351 - 420
PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPP    421 - 490
PPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGSIPPWQQQQAAAAASPGAPQM    491 - 560
QGNPTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPPMDPSNFVTMMGMGVAGMPPFGMPP    561 - 630
APPPPPPQN                                                                 631 - 639
//

Text Mined References (65)

PMID Year Title