Property Summary

NCBI Gene PubMed Count 54
PubMed Score 161.39
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.500 2.2e-07
astrocytic glioma 1.100 4.6e-03
ependymoma 1.300 5.7e-03
oligodendroglioma 1.500 4.6e-03
psoriasis -1.300 1.3e-03
osteosarcoma -1.294 7.1e-04
group 3 medulloblastoma 2.100 3.1e-06
atypical teratoid/rhabdoid tumor 1.300 1.2e-08
medulloblastoma, large-cell 1.500 2.2e-05
primitive neuroectodermal tumor 1.400 7.2e-05
intraductal papillary-mucinous adenoma (... 1.200 7.1e-04
lung cancer 1.500 1.5e-04
ovarian cancer 1.300 2.5e-05

Protein-protein Interaction (10)

Gene RIF (31)

PMID Text
26813693 results indicate that ATF7IP does not directly modulate SETDB1 catalytic activity, suggesting alternate roles, such as affecting cellular localization or mediating interaction with additional binding partners.
26481868 SETDB1 is an oncogene that is frequently up-regulated in human HCCs; the multiplicity of SETDB1 activating mechanisms at the chromosomal, transcriptional, and posttranscriptional levels together facilitates SETDB1 up-regulation in human HCC
26471002 regulates cancer cell growth via methylation of p53
26296461 SETDB1, localized in the nucleus, might undergo degradation by the proteasome and be exported to the cytosol, resulting in its detection mainly in the cytosol.
25715926 Exogenous expression of MyoD reversed transcriptional repression of MyoD promoter-driven lucif-erase reporter by Setdb1 shRNA and rescued myogenic differentiation of C2C12 myoblast cells depleted of endogenous Setdb1.
25569264 Authors demonstrate that a KMT1E-containing complex directly interacts with the FcgammaRIIb promoter and that histone H3 at lysine 9 tri-methylation at this promoter is dependent on Setdb1
25477335 Together, our findings defined an essential role for the KMT1E/SMAD2/3 repressor complex in TGFbeta-mediated lung cancer metastasis.
25404354 Report elevated levels of SETDB1 in non-small lung cancers, associated with neoplasm grading and tumor growth.
25070049 MiR-7, inhibited indirectly by lincRNA HOTAIR, directly inhibits SETDB1 and reverses the Epithelial-mesenchymal transition of breast cancer stem cells by down regulating the STAT3 pathway
24760766 This observation suggests that the ZNF274/SETDB1 complex bound to the SNORD116 cluster may protect the Prader-Willi syndrome induced pluripotent cells from DNA demethylation during early development.
24673285 SETDB1 is associated with frequent methylation of the euchromatic p16(INK) (4A) promoter and several prognostic parameters in melanomas
24658378 overexpression of SETDB1 or LSD1 had no prognostic impact in patients with melanoma
24556744 data suggested that SETDB1 is overexpressed in human PCa. Silencing SETDB1 inhibited PCa cell proliferation, migration and invasion
24056368 of ESET plays an essential role in the maintenance of articular cartilage by preventing articular chondrocytes from terminal differentiation and may have implications in joint diseases such as osteoarthritis.
23943221 SETDB1 expression was upregulated in glioma cell lines and in glioma tissues compared to normal brain, being positively correlated with grade and histological malignancy.
23770855 SETDB1 is a bona fide oncogene undergoing gene amplification-associated activation in lung cancer.
23055267 A transgenic Setdb1 model established a link between this gene and behavior.
22405323 Knockdown of SET domain, bifurcated 1 (SETDB1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
22082156 Knockdown of SET domain, bifurcated 1 (SETDB1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21430779 studies establish SETDB1 as an oncogene in melanoma and underscore the role of chromatin factors in regulating tumorigenesis
21170338 analysis of a KRAB domain-containing ZNF (ZNF274) that is involved in recruitment of the KAP1 and SETDB1 to specific regions of the human genome
19124506 Observational study of gene-disease association. (HuGE Navigator)
18498648 SETDB1 can specifically methylate HIV-1 Tat preferentially at lysine 51.
18498648 HIV-1 Tat associates with and is methylated at lysine's 50 and 51 by SETDB1. SETDB1 knockdown increases the transactivation of the HIV-1 LTR
17577629 Akt/PKB interacts with the histone H3 methyltransferase SETDB1 and coordinates to silence gene expression.
17142323 modulation of gene silencing mechanisms, through regulation of the ESET gene is important to neuronal survival and, as such, may be a promising treatment in Huntington's disease patients
16682412 histone methyltransferase SETDB1 and the DNA methyltransferase DNMT3A interact directly and localize to promoters silenced in cancer cells
15691849 These data suggest that MBD1.MCAF1.SETDB1 complex facilitates the formation of heterochromatic domains, emphasizing the role of MCAF/AM family proteins in epigenetic control, and describe a new family member, MCAF2 (ATF7IP2).
15327775 Data show that the methyl-CpG binding protein MBD1 forms a stable complex with histone H3-K9 methylase SETDB1.
14536086 mAM/hAM facilitates conversion of H3-K9 dimethyl to trimethyl by ESET/SETDB1
11959841 Contributes to HP1-mediated silencing of euchromatic genes by KRAB zinc-finger proteins; KAP-1, SETDB1, H3-MeK9, and HP1 are enriched at promoter sequences of a euchromatic gene silenced by the KRAB-KAP-1 repression system

AA Sequence

MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQ      1 - 70
KESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPTEIIEIPDEDDDVLSIDSGDA     71 - 140
GSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDLHKGTLSQMSGELSKDGDLIVSMRILGKKRT    141 - 210
KTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGI    211 - 280
VAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKS    281 - 350
GQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRP    351 - 420
NMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSDLESQLAQSRKQVAKK    421 - 490
STSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAPSALPAPPAPPVFHGMLERAPA    491 - 560
EPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTP    561 - 630
CGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTT    631 - 700
PPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRL    701 - 770
EECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDD    771 - 840
FADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNF    841 - 910
CKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPVPPSIPVGGCNPPSSEETPKNK    911 - 980
VASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRMEAEKASTSGLGIKDEGDIKQAKKEDTDDRNK    981 - 1050
MSVVTESSRNYGYNPSPVKPEGLRRPPSKTSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTA   1051 - 1120
GQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGES   1121 - 1190
APVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTE   1191 - 1260
LTWDYNYEVGSVEGKELLCCCGAIECRGRLL                                          1261 - 1291
//

Text Mined References (67)

PMID Year Title
27029610 2016 ATRX binds to atypical chromatin domains at the 3' exons of zinc finger genes to preserve H3K9me3 enrichment.
26813693 2016 Characterization of the Enzymatic Activity of SETDB1 and Its 1:1 Complex with ATF7IP.
26481868 2016 Up-regulation of histone methyltransferase SETDB1 by multiple mechanisms in hepatocellular carcinoma promotes cancer metastasis.
26471002 2015 Histone methyltransferase SETDB1 regulates liver cancer cell growth through methylation of p53.
26296461 2015 Analysis of the subcellular localization of the human histone methyltransferase SETDB1.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25715926 2015 Setdb1 is required for myogenic differentiation of C2C12 myoblast cells via maintenance of MyoD expression.
25569264 2015 KMT1E-mediated chromatin modifications at the Fc?RIIb promoter regulate thymocyte development.
25477335 2014 H3K9 histone methyltransferase, KMT1E/SETDB1, cooperates with the SMAD2/3 pathway to suppress lung cancer metastasis.
25404354 2015 SETDB1 accelerates tumourigenesis by regulating the WNT signalling pathway.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25070049 2014 MiR-7, inhibited indirectly by lincRNA HOTAIR, directly inhibits SETDB1 and reverses the EMT of breast cancer stem cells by downregulating the STAT3 pathway.
24760766 2014 Reactivation of maternal SNORD116 cluster via SETDB1 knockdown in Prader-Willi syndrome iPSCs.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24673285 2014 High-frequency p16(INK) (4A) promoter methylation is associated with histone methyltransferase SETDB1 expression in sporadic cutaneous melanoma.
24658378 2014 Immunohistochemistry for histone h3 lysine 9 methyltransferase and demethylase proteins in human melanomas.
24623306 2014 A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.
24556744 Histone methyltransferase SETDB1 is required for prostate cancer cell proliferation, migration and invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24056368 2013 Mesenchyme-specific knockout of ESET histone methyltransferase causes ectopic hypertrophy and terminal differentiation of articular chondrocytes.
23943221 2014 Role of histone lysine methyltransferases SUV39H1 and SETDB1 in gliomagenesis: modulation of cell proliferation, migration, and colony formation.
23770855 2014 Gene amplification of the histone methyltransferase SETDB1 contributes to human lung tumorigenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23055267 2012 The expanding role of MBD genes in autism: identification of a MECP2 duplication and novel alterations in MBD5, MBD6, and SETDB1.
21983785 2011 Genome-wide association study identifies a new melanoma susceptibility locus at 1q21.3.
21430779 2011 The histone methyltransferase SETDB1 is recurrently amplified in melanoma and accelerates its onset.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21170338 2010 ZNF274 recruits the histone methyltransferase SETDB1 to the 3' ends of ZNF genes.
20871592 2010 Methyl-H3K9-binding protein MPP8 mediates E-cadherin gene silencing and promotes tumour cell motility and invasion.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19061646 2008 CDYL bridges REST and histone methyltransferases for gene repression and suppression of cellular transformation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18498648 2008 Lysine methylation of HIV-1 Tat regulates transcriptional activity of the viral LTR.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17952062 2007 A histone lysine methyltransferase activated by non-canonical Wnt signalling suppresses PPAR-gamma transactivation.
17577629 2007 Akt/PKB interacts with the histone H3 methyltransferase SETDB1 and coordinates to silence gene expression.
17142323 2006 ESET/SETDB1 gene expression and histone H3 (K9) trimethylation in Huntington's disease.
17066076 2006 Regulation of MBD1-mediated transcriptional repression by SUMO and PIAS proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16682412 2006 The histone methyltransferase SETDB1 and the DNA methyltransferase DNMT3A interact directly and localize to promoters silenced in cancer cells.
16567619 2006 NXP-2 association with SUMO-2 depends on lysines required for transcriptional repression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15899859 2005 In vivo HP1 targeting causes large-scale chromatin condensation and enhanced histone lysine methylation.
15691849 2005 Transcriptional repression and heterochromatin formation by MBD1 and MCAF/AM family proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15327775 2004 Methyl-CpG binding protein MBD1 couples histone H3 methylation at lysine 9 by SETDB1 to DNA replication and chromatin assembly.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14536086 2003 mAM facilitates conversion by ESET of dimethyl to trimethyl lysine 9 of histone H3 to cause transcriptional repression.
12869583 2003 Regulated recruitment of HP1 to a euchromatic gene induces mitotically heritable, epigenetic gene silencing: a mammalian cell culture model of gene variegation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12398767 2003 An ERG (ets-related gene)-associated histone methyltransferase interacts with histone deacetylases 1/2 and transcription co-repressors mSin3A/B.
11959841 2002 SETDB1: a novel KAP-1-associated histone H3, lysine 9-specific methyltransferase that contributes to HP1-mediated silencing of euchromatic genes by KRAB zinc-finger proteins.
11791185 2002 Molecular cloning of ESET, a novel histone H3-specific methyltransferase that interacts with ERG transcription factor.
10343109 1999 Assignment of a novel bifurcated SET domain gene, SETDB1, to human chromosome band 1q21 by in situ hybridization and radiation hybrids.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.