Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 1.24349070656478E-6
glioblastoma 5572 5.01943653620011E-4
pilocytic astrocytoma 3086 0.00248395952698641
aldosterone-producing adenoma 664 0.0056727998826322
pediatric high grade glioma 2712 0.00667307207763522
primitive neuroectodermal tumor 3031 0.0151827095848385
active Crohn's disease 918 0.0185871296329823
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0309839650767049

Expression

  Differential Expression (8)

Synonym

Accession Q8NE22 F5H713
Symbols C5orf35

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MPGRLLRGLWQRWRRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLGTLLKVFQALFLNDFNK      1 - 70
QSEILSMLPESVKSKYQDLLAVEHQGVKLLENRHQQQSTFKPEEILYKTLGFSVAQATSSLISAGKGVFV     71 - 140
TKGLVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLDGVLIDGNDKGISKVVYRSCNGRDRLGPLKM    141 - 210
SDSTWLTSEIHNPLAVGQYVNNCSNDRAANVCYQEFDVPAVFPIELKQYLPNIAYSYDKQSPLRCVVLVA    211 - 280
LRDINQGEELFSNYYTIVS                                                       281 - 299
//

Text Mined References (4)

PMID Year Title
20930037 2011 Uncovering the human methyltransferasome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.