Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -1.341 1.9e-02
active ulcerative colitis -1.631 1.9e-02
aldosterone-producing adenoma -1.423 5.7e-03
Astrocytoma, Pilocytic 1.400 1.4e-03
glioblastoma 1.400 5.0e-04
pancreatic ductal adenocarcinoma liver m... -1.345 3.1e-02
pediatric high grade glioma 1.100 6.7e-03
primitive neuroectodermal tumor 1.600 1.5e-02

Gene RIF (1)

AA Sequence

MPGRLLRGLWQRWRRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLGTLLKVFQALFLNDFNK      1 - 70
QSEILSMLPESVKSKYQDLLAVEHQGVKLLENRHQQQSTFKPEEILYKTLGFSVAQATSSLISAGKGVFV     71 - 140
TKGLVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLDGVLIDGNDKGISKVVYRSCNGRDRLGPLKM    141 - 210
SDSTWLTSEIHNPLAVGQYVNNCSNDRAANVCYQEFDVPAVFPIELKQYLPNIAYSYDKQSPLRCVVLVA    211 - 280
LRDINQGEELFSNYYTIVS                                                       281 - 299
//

Text Mined References (5)

PMID Year Title