Property Summary

Ligand Count 3
NCBI Gene PubMed Count 71
PubMed Score 139.85
PubTator Score 74.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 1.282 7.0e-03
atypical teratoid / rhabdoid tumor -1.900 4.4e-06
ependymoma -1.100 1.4e-05
invasive ductal carcinoma -1.100 1.1e-02
ovarian cancer -2.500 6.0e-07
pancreatic ductal adenocarcinoma liver m... -1.359 4.8e-03
pituitary cancer -1.600 8.5e-06
ulcerative colitis 1.200 8.2e-06

PDB (31)

Gene RIF (56)

AA Sequence

MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQG      1 - 70
QGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMT     71 - 140
GEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDP    141 - 210
YESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEP    211 - 280
YNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAP    281 - 350
EWYQVELKAFQATQQK                                                          351 - 366
//

Text Mined References (77)

PMID Year Title