Property Summary

NCBI Gene PubMed Count 59
PubMed Score 126.95
PubTator Score 74.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.100 1.4e-05
atypical teratoid/rhabdoid tumor -2.000 2.5e-08
pancreatic ductal adenocarcinoma liver m... -1.359 4.8e-03
active Crohn's disease 1.282 7.0e-03
invasive ductal carcinoma -1.100 1.1e-02
ulcerative colitis 1.200 8.2e-06
ovarian cancer -2.500 6.0e-07
pituitary cancer -1.600 8.5e-06

 GWAS Trait (1)

Gene RIF (46)

PMID Text
26890252 Knock-down of SETD7 causes differentiation defects in human embryonic stem cell including delay in both the silencing of pluripotency-related genes and the induction of differentiation genes.
26861389 study identified a novel locus associated with serum lycopene concentrations and results raise a number of possibilities regarding the nature of the relationship between SETD7 and lycopene, both independently associated with prostate cancer.
26701885 Reduced expression of SET7 is associated with gastric cancer progression.
26435321 Lysine methylation by SETD7 is important for the fine-tuning of reactive oxygen species signaling through its regulation on pro-inflammatory responses.
26317544 Unleashed expression of Mdm2 in cancer patients with diminished expression of Set7/9 is associated with poor survival outcome.
26116705 Findings indicate the regulation of Wnt/beta-catenin signaling and the role of SET domain-containing protein 7/9 (SET7/9) in cancer cells.
25954928 Based on our results miR-153 inhibits proliferation and suppresses EMT and the invasive potential of ovarian cancer cells through downregulation of SET7 and ZEB2, supporting the pursuit of miR-153 as a potential target for ovarian cancer intervention.
25681344 Results show that histone-lysine N-methyltransferase Set7 facilitates hepatitis C virus (HCV) replication through the attenuation of interferon-alpha (IFN-alpha) signaling pathways and IFN-related effectors.
25637186 SET9 enriches at hypoxia response elements sites of HIF-1 responsive glycolytic genes and stabilizes HIF-1alpha at these sites in hypoxia.
25472959 Set7-induced epigenetic changes contribute to vascular dysfunction in patients with T2DM.
25124555 Set7/9 is a potential biomarker in tumour cells and is associated with overexpressed E2F1 activity.
25042802 Results show Set7 efficiently monomethylates Sox2 at K119 residue controling its stability.
24875254 Set7-dependent gene expression changes that occurred independent of H3K4m1 may involve transcription factor lysine methylation events.
24129573 Vesicular stomatitis virus and influenza A virus increased IFITM3-K88me1 levels by promoting the interaction between IFITM3 and SET7, suggesting that this pathway could be hijacked to support infection; conversely, IFN-alpha reduced IFITM3-K88me1 levels.
23873758 study indicates that Set7/9 prevents the histone deacetylase activity of SirT1, potentiating euchromatin formation on the promoter site of COL2A1 and resulting in morphology-dependent COL2A1 gene transactivation.
23519668 The crystal structures presented here provide information about the binding of both AdoMet-analogue inhibitors and peptides by the SET domain of SET7/9.
23509280 Methylation of SUV39H1 by SET7/9 results in heterochromatin relaxation and genome instability.
22820736 The methyltransferase Set9 directly methylates FoxO3 in vitro and in cells. The modulation of FoxO3 stability and activity by methylation may be critical for fine-tuning cellular responses to stress stimuli.
22406368 H3K4me3 level defines unrecognized subsets of heptaocellular carcinoma patients with distinct epigenetic phenotype and clinical outcome and can thus be a novel predictor for poor prognosis of heptaocellular carcinoma patients
22403242 The response to hyperglycemia in vascular endothelial cells involves Set7 mediated changes in chromatin remodeling and gene expression.
22242964 simulations show that while the wild-type SET7/9 is a monomethylase, the Y245-->A mutation increases the ability of the enzyme to add more methyl groups on the target lysine
21896933 genetic association studies in a Finnish population with type I diabetes: No associations were found between SNPs in SETD7 and the diabetic complications studied.
21454678 Direct evidence for methyl group coordination by carbon-oxygen hydrogen bonds in the lysine methyltransferase SET7/9.
21273441 Set9 directly acts on AR at the amino acid level. Chromatin recruitment of Set9 to AREs is suggestive of its additional role as a transcriptional coactivator.
21245319 results reveal that Set7/9 is a critical regulator of the SIRT1-p53 interaction and suggest that Set7/9 can modulate p53 function indirectly in addition to acting through a methylation-dependent mechanism
21098664 Data show that STAT3 binds to the SOCS3 promoter, and S727 is then phosphorylated, followed by the coincident binding of SET9 and dimethylation of K140, and lastly by the binding of LSD1.
20675860 SET7/9 catalytic mutants reveal the role of active site water molecules in lysine multiple methylation
20615470 HIV-1 Tat is methylated at residue lysine 51 in its RNA-binding domain by SET7/9-KMT7
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20227666 Set7/9-KMT7 associates with the HIV promoter in vivo and monomethylates lysine 51, a highly conserved residue located in the RNA-binding domain of Tat.
20227666 HIV-1 Tat is methylated at residue lysine 51 in its RNA-binding domain by SET7/9-KMT7
20227660 HIV-1 Tat is methylated at residue lysine 51 in its RNA-binding domain by SET7/9-KMT7
19752191 the binding of two SET domain-containing proteins, ALL1 and SET7, to chromatin substrates was studied.
19351588 These data may lead to a new insight into PCAF functions and provide additional information to identify unknown targets of Set9.
19282482 signaling through SET7 represents a means of DNMT1 enzyme turnover
19262565 Data show that lysine methyltransferase Set9 physically associates with RelA in vitro and in vivo in response to TNF-alpha.
18650421 a novel role for SET7/9 in inflammation and diabetes.
18474616 This report shows that H3K9 monomethylation is dependent upon the PR-Set7 H4K20 monomethyltransferase but independent of its catalytic function, indicating that PR-Set7 recruits an H3K9 monomethyltransferase to establish the trans-tail histone code.
18471979 Results show that estrogen receptor alpha is directly methylated at lysine 302 (K302) by the SET7 methyltransferase.
17646389 Results suggest that the cross talk between lysine methylation and acetylation is critical for p53 activation in response to DNA damage and that Set7/9 may play an important role in tumor suppression.
17573780 RBP2 associates with MRG15 complex to maintain reduced H3K4 methylation at transcribed regions, which may ensure the transcriptional elongation state
16415881 SET7/9 recognizes a conserved K/R-S/T/A motif preceding the lysine substrate and has a propensity to bind aspartates and asparagines on the C-terminal side of the lysine target
12670868 This enzyme and human Sin3 deacetylase are tethered together selectively by the cell-proliferation factor HCF-1.
12540855 Crystal structure and catalytic mechanism of the human histone methyltransferase SET7/9
12372304 crystal structure of human SET7/9 shows residues essential for catalytic activity with histone H3
11779497 purification and functional characterization of a histone H3-lysine 4-specific methyltransferase

AA Sequence

MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQG      1 - 70
QGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMT     71 - 140
GEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDP    141 - 210
YESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEP    211 - 280
YNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAP    281 - 350
EWYQVELKAFQATQQK                                                          351 - 366
//

Text Mined References (65)

PMID Year Title
26890252 2016 SETD7 Regulates the Differentiation of Human Embryonic Stem Cells.
26861389 2016 A Common Variant in the SETD7 Gene Predicts Serum Lycopene Concentrations.
26701885 2016 Reduced expression of SET7/9, a histone mono-methyltransferase, is associated with gastric cancer progression.
26435321 2015 Lysine Methyltransferase SETD7 (SET7/9) Regulates ROS Signaling through mitochondria and NFE2L2/ARE pathway.
26317544 2015 KMT Set7/9 affects genotoxic stress response via the Mdm2 axis.
26116705 2015 SET7/9 regulates cancer cell proliferation by influencing ?-catenin stability.
25954928 2015 MicroRNA-153 functions as a tumor suppressor by targeting SET7 and ZEB2 in ovarian cancer cells.
25681344 2015 Set7 facilitates hepatitis C virus replication via enzymatic activity-dependent attenuation of the IFN-related pathway.
25637186 2015 Functional regulation of hypoxia inducible factor-1? by SET9 lysine methyltransferase.
25472959 2015 Adverse epigenetic signatures by histone methyltransferase Set7 contribute to vascular dysfunction in patients with type 2 diabetes mellitus.
25124555 2014 KMTase Set7/9 is a critical regulator of E2F1 activity upon genotoxic stress.
25042802 2014 A methylation-phosphorylation switch determines Sox2 stability and function in ESC maintenance or differentiation.
24875254 2014 Deep sequencing reveals novel Set7 networks.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129573 2013 Negative regulation of interferon-induced transmembrane protein 3 by SET7-mediated lysine monomethylation.
23873758 2014 Set7/9 impacts COL2A1 expression through binding and repression of SirT1 histone deacetylation.
23519668 2013 Structures of histone methyltransferase SET7/9 in complexes with adenosylmethionine derivatives.
23509280 2013 Methylation of SUV39H1 by SET7/9 results in heterochromatin relaxation and genome instability.
22820736 2012 Methylation by Set9 modulates FoxO3 stability and transcriptional activity.
22406368 2012 High expression of trimethylated histone H3 lysine 4 is associated with poor prognosis in hepatocellular carcinoma.
22403242 2012 Distinguishing hyperglycemic changes by Set7 in vascular endothelial cells.
22402663 2012 Lysine methylation of FOXO3 regulates oxidative stress-induced neuronal cell death.
22345554 2012 Direct methylation of FXR by Set7/9, a lysine methyltransferase, regulates the expression of FXR target genes.
22242964 2012 Understanding product specificity of protein lysine methyltransferases from QM/MM molecular dynamics and free energy simulations: the effects of mutation on SET7/9 beyond the Tyr/Phe switch.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21896933 2011 Genetic examination of SETD7 and SUV39H1/H2 methyltransferases and the risk of diabetes complications in patients with type 1 diabetes.
21454678 2011 Direct evidence for methyl group coordination by carbon-oxygen hydrogen bonds in the lysine methyltransferase SET7/9.
21273441 2011 Lysine methylation and functional modulation of androgen receptor by Set9 methyltransferase.
21269460 2011 Initial characterization of the human central proteome.
21245319 2011 Methyltransferase Set7/9 regulates p53 activity by interacting with Sirtuin 1 (SIRT1).
21131967 2011 Lysine methylation of the NF-?B subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-?B signaling.
21119616 2011 Interplay between lysine methylation and Cdk phosphorylation in growth control by the retinoblastoma protein.
21098664 2010 Reversible methylation of promoter-bound STAT3 by histone-modifying enzymes.
20675860 2010 SET7/9 catalytic mutants reveal the role of active site water molecules in lysine multiple methylation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20227666 2010 The Cellular lysine methyltransferase Set7/9-KMT7 binds HIV-1 TAR RNA, monomethylates the viral transactivator Tat, and enhances HIV transcription.
19752191 2010 SET domains of histone methyltransferases recognize ISWI-remodeled nucleosomal species.
19351588 2009 Multiple lysine methylation of PCAF by Set9 methyltransferase.
19282482 2009 Regulation of DNMT1 stability through SET7-mediated lysine methylation in mammalian cells.
19262565 2009 Negative regulation of NF-kappaB action by Set9-mediated lysine methylation of the RelA subunit.
19247474 2009 Genome-wide and candidate gene association study of cigarette smoking behaviors.
18650421 2008 Role of the histone H3 lysine 4 methyltransferase, SET7/9, in the regulation of NF-kappaB-dependent inflammatory genes. Relevance to diabetes and inflammation.
18474616 2008 PR-Set7 establishes a repressive trans-tail histone code that regulates differentiation.
18471979 2008 Regulation of estrogen receptor alpha by the SET7 lysine methyltransferase.
17707234 2007 Modulation of p53 function by SET8-mediated methylation at lysine 382.
17646389 2007 Methylation-acetylation interplay activates p53 in response to DNA damage.
17573780 2007 RBP2 is an MRG15 complex component and down-regulates intragenic histone H3 lysine 4 methylation.
17108971 2006 Repression of p53 activity by Smyd2-mediated methylation.
16433545 2006 Catalytic mechanism and product specificity of the histone lysine methyltransferase SET7/9: an ab initio QM/MM-FE study with multiple initial structures.
16415881 2006 Structural basis for the methylation site specificity of SET7/9.
16141209 2005 Pdx-1 links histone H3-Lys-4 methylation to RNA polymerase II elongation during activation of insulin transcription.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15525938 2004 Regulation of p53 activity through lysine methylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15099517 2004 Gene-specific modulation of TAF10 function by SET9-mediated methylation.
12670868 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.
12588998 2003 Cascade of distinct histone modifications during collagenase gene activation.
12540855 2003 Structure and catalytic mechanism of the human histone methyltransferase SET7/9.
12514135 2003 Mechanism of histone lysine methyl transfer revealed by the structure of SET7/9-AdoMet.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12389038 2002 The active site of the SET domain is constructed on a knot.
12372304 2002 Crystal structure and functional analysis of the histone methyltransferase SET7/9.
11850410 2002 Set9, a novel histone H3 methyltransferase that facilitates transcription by precluding histone tail modifications required for heterochromatin formation.
11779497 2001 Purification and functional characterization of a histone H3-lysine 4-specific methyltransferase.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.