Property Summary

NCBI Gene PubMed Count 38
PubMed Score 346.28
PubTator Score 238.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7933 4.6e-12
psoriasis 6685 1.6e-04
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Schizophrenia 503

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 1.6e-04
osteosarcoma -2.424 4.6e-12

Gene RIF (23)

PMID Text
26974950 Loss-of-function variants in SETD1A cause a range of neurodevelopmental disorders in a Finnish population.
26938441 This study demonstrated that SETD1A mutation showing the highest statistical significance in Autism and Schizophrenia.
26691508 Set1 role in cellular reprogramming and its interactions with Dpy30,Myc,Sox2 and Ash2l reprogramming factors
26581161 Findings provide evidence that SET1A cooperates with CUDR to play a positive potential role during hepatocarcinogenesis and hepatocyte-like stem cells' malignant transformation epigenetically.
26478434 Set1/MLL complex is indispensable for the transcriptional ability of HSF2.
26394836 suppresses BTG2 expression through its induction of several BTG2-targeting miRNAs
26015494 results demonstrate a novel function of BAF as an epigenetic regulator of HSV lytic infection; hypothesize that BAF facilitates Herpes Simplex Virus IE and E gene expression by recruiting the SETD1A methyltransferase to viral IE and E gene promoters
25561738 these results form the basis for understanding how WRAD(DRY-30) differentially regulates SET1 family complexes in vivo.
25542209 Based on our structural data and cross-linking results, we suggest that Dpy30 may regulate H3K4 methylation according to its copy number in COMPASS
25373480 Study reveals that SETD1A controls tumor metastasis by activating matrix metalloproteinases (MMP) expression and provides an epigenetic link among SETD1A, MMPs, and metastasis of breast cancer.
25033463 Co-immunoprecipitation demonstrated LANA association with endogenous hSET1 complexes in both lymphoid and endothelial cells suggesting that LANA may contribute to the epigenetic profile of KSHV episomes
24853937 This study demonistrated that Loss-of-function variants of loss of function variants of SETD1A is a canadate susceptibility of Schizophrenia.
24247718 hSETD1A regulates Wnt target genes and controls tumor growth of colorectal cancer cells.
23754954 our findings reveal that the guided-recruitment of the hSET1A histone methyltransferase complex and its H3K4 methyltransferase activity by transcription regulator USF1 safeguards hematopoietic transcription programs
23306522 These results demonstrate that the increase of H3K4me3 by human Set1 complex is involved in activation of lytic genes during the lytic infection of KSHV.
21653943 A synergistic role of hSET1 and NURF in regulating the USF-bound barrier insulator to prevent erythroid genes from encroachment of heterochromatin.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19454010 Three components (Setd1A, CXXC1, WDR5) of the Set1 histone methyltransferase complex are identified to interact with HIV-1 Tat in Jurkat cell
18838538 Data show that Wdr82, which associates with chromatin in a histone H2B ubiquitination-dependent manner, is a specific component of Set1 complexes but not that of MLL1-4 complexes.
18765639 BORIS acts as a platform upon which BAT3 and SET1A assemble and exert effects upon chromatin structure and gene expression.
18082152 CGBP interacts with MLL1, MLL2 as well as Set1 H3-Lysine 4 (H3K4) specific methyl-transferases and plays critical roles in regulations of MLL target genes.
17998332 suggest a model for how the mammalian RNA polymerase II machinery is linked with histone H3-Lys4 histone methyltransferase complexes at transcriptionally active genes
17578910 HCF-1 was required for recruitment of the histone methyltransferases Set1 and MLL1, leading to histone H3K4 trimethylation and transcriptional activation.

AA Sequence

MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDLQDPRCHVRSK      1 - 70
NRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARV     71 - 140
LFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYYELIVNGSYTPQTVPTGGKALSEKFQGSGAA    141 - 210
TETAESRRRSSSDTAAYPAGTTAVGTPGNGTPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTP    211 - 280
YSQDSAYSSSTTSTSFKPRRSENSYQDAFSRRHFSASSASTTASTAIAATTAATASSSASSSSLSSSSSS    281 - 350
SSSSSSSQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRP    351 - 420
TDQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEVRTSPRPASPARSGSPAPETTNESVPFAQHSSLDS    421 - 490
RIEMLLKEQRSKFSFLASDTEEEEENSSMVLGARDTGSEVPSGSGHGPCTPPPAPANFEDVAPTGSGEPG    491 - 560
ATRESPKANGQNQASPCSSGDDMEISDDDRGGSPPPAPTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQP    561 - 630
AYLLPPRPDGPPPPEYPPPPPPPPHIYDFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLI    631 - 700
AASAGPPGGAFGEAFLPFPPPQEAAYGLPYALYAQGQEGRGAYSREAYHLPMPMAAEPLPSSSVSGEEAR    701 - 770
LPPREEAELAEGKTLPTAGTVGRVLAMLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNA    771 - 840
AKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEPSEISEASEEK    841 - 910
RPRPSTPAEEDEDDPEQEKEAGEPGRPGTKPPKRDEERGKTQGKHRKSFALDSEGEEASQESSSEKDEED    911 - 980
DEEDEEDEDREEAVDTTKKETEVSDGEDEESDSSSKCSLYADSDGENDSTSDSESSSSSSSSSSSSSSSS    981 - 1050
SSSSSSSSESSSEDEEEEERPAALPSASPPPREVPVPTPAPVEVPVPERVAGSPVTPLPEQEASPARPAG   1051 - 1120
PTEESPPSAPLRPPEPPAGPPAPAPRPDERPSSPIPLLPPPKKRRKTVSFSAIEVVPAPEPPPATPPQAK   1121 - 1190
FPGPASRKAPRGVERTIRNLPLDHASLVKSWPEEVSRGGRSRAGGRGRLTEEEEAEPGTEVDLAVLADLA   1191 - 1260
LTPARRGLPALPAVEDSEATETSDEAERPRPLLSHILLEHNYALAVKPTPPAPALRPPEPVPAPAALFSS   1261 - 1330
PADEVLEAPEVVVAEAEEPKPQQLQQQREEGEEEGEEEGEEEEEESSDSSSSSDGEGALRRRSLRSHARR   1331 - 1400
RRPPPPPPPPPPRAYEPRSEFEQMTILYDIWNSGLDSEDMSYLRLTYERLLQQTSGADWLNDTHWVHHTI   1401 - 1470
TNLTTPKRKRRPQDGPREHQTGSARSEGYYPISKKEKDKYLDVCPVSARQLEGVDTQGTNRVLSERRSEQ   1471 - 1540
RRLLSAIGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMR   1541 - 1610
EKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEI   1611 - 1680
TYDYKFPLEDNKIPCLCGTESCRGSLN                                              1681 - 1707
//

Text Mined References (47)

PMID Year Title
27141965 2016 Setd1a and NURF mediate chromatin dynamics and gene regulation during erythroid lineage commitment and differentiation.
26974950 2016 Rare loss-of-function variants in SETD1A are associated with schizophrenia and developmental disorders.
26938441 2016 De Novo Synonymous Mutations in Regulatory Elements Contribute to the Genetic Etiology of Autism and Schizophrenia.
26691508 2015 Physical Interactions and Functional Coordination between the Core Subunits of Set1/Mll Complexes and the Reprogramming Factors.
26581161 2016 SET1A Cooperates With CUDR to Promote Liver Cancer Growth and Hepatocyte-like Stem Cell Malignant Transformation Epigenetically.
26478434 2015 Set1/MLL complex is indispensable for the transcriptional ability of heat shock transcription factor 2.
26394836 2015 SETD1A modulates cell cycle progression through a miRNA network that regulates p53 target genes.
26015494 2015 Barrier-to-Autointegration Factor 1 (BAF/BANF1) Promotes Association of the SETD1A Histone Methyltransferase with Herpes Simplex Virus Immediate-Early Gene Promoters.
25561738 2015 Biochemical reconstitution and phylogenetic comparison of human SET1 family core complexes involved in histone methylation.
25542209 2015 Structural implications of Dpy30 oligomerization for MLL/SET1 COMPASS H3K4 trimethylation.
25373480 2015 Histone Methyltransferase hSETD1A Is a Novel Regulator of Metastasis in Breast Cancer.
25033463 2014 LANA binds to multiple active viral and cellular promoters and associates with the H3K4methyltransferase hSET1 complex.
24853937 2014 Loss-of-function variants in schizophrenia risk and SETD1A as a candidate susceptibility gene.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247718 2014 hSETD1A regulates Wnt target genes and controls tumor growth of colorectal cancer cells.
23870121 2013 SET1 and p300 act synergistically, through coupled histone modifications, in transcriptional activation by p53.
23754954 2013 USF1 and hSET1A mediated epigenetic modifications regulate lineage differentiation and HoxB4 transcription.
23306522 2013 Alteration of histone H3 lysine 4 trimethylation on putative lytic gene promoters by human Set1 complex during reactivation of Kaposi's sarcoma-associated herpesvirus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178126 2012 Microcephaly gene links trithorax and REST/NRSF to control neural stem cell proliferation and differentiation.
23130995 2013 Skirting the pitfalls: a clear-cut nomenclature for H3K4 methyltransferases.
22843687 2012 The histone chaperone Spt6 is required for activation-induced cytidine deaminase target determination through H3K4me3 regulation.
22723415 2012 Wnt/?-catenin signaling regulates telomerase in stem cells and cancer cells.
21653943 2011 Chromatin boundaries require functional collaboration between the hSET1 and NURF complexes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20862685 2011 Contribution of H3K4 methylation by SET-1A to interleukin-1-induced cyclooxygenase 2 and inducible nitric oxide synthase expression in human osteoarthritis chondrocytes.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20622854 2010 PHF8 mediates histone H4 lysine 20 demethylation events involved in cell cycle progression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18838538 2008 Molecular regulation of H3K4 trimethylation by Wdr82, a component of human Set1/COMPASS.
18765639 2008 BAT3 and SET1A form a complex with CTCFL/BORIS to modulate H3K4 histone dimethylation and gene expression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18082152 2008 Human CpG binding protein interacts with MLL1, MLL2 and hSet1 and regulates Hox gene expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17998332 2008 Wdr82 is a C-terminal domain-binding protein that recruits the Setd1A Histone H3-Lys4 methyltransferase complex to transcription start sites of transcribed human genes.
17578910 2007 The coactivator host cell factor-1 mediates Set1 and MLL1 H3K4 trimethylation at herpesvirus immediate early promoters for initiation of infection.
17500065 2007 PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex.
17355966 2007 Identification and characterization of the human Set1B histone H3-Lys4 methyltransferase complex.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16253997 2005 CpG-binding protein (CXXC finger protein 1) is a component of the mammalian Set1 histone H3-Lys4 methyltransferase complex, the analogue of the yeast Set1/COMPASS complex.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12670868 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.