Property Summary

NCBI Gene PubMed Count 52
PubMed Score 92.58
PubTator Score 39.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Hepatomegaly 285 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 4.2e-05
medulloblastoma, large-cell 6241 6.1e-05
tuberculosis 2010 8.1e-05
Pick disease 1894 4.2e-04
group 3 medulloblastoma 4104 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.036 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.300 1.3e-03
medulloblastoma, large-cell -1.100 6.1e-05
osteosarcoma 2.223 4.2e-05
Pick disease 1.100 4.2e-04
tuberculosis -1.100 8.1e-05

Gene RIF (39)

AA Sequence

MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEAL      1 - 70
MSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTG     71 - 140
GDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSF    141 - 210
VFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQ    211 - 280
EEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYS    281 - 350
LIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN    351 - 420
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT              421 - 480
//

Text Mined References (58)

PMID Year Title