Property Summary

NCBI Gene PubMed Count 17
PubMed Score 76.06
PubTator Score 21.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.942 3.6e-06
malignant mesothelioma -1.700 5.8e-07
glioblastoma -1.400 3.7e-03
medulloblastoma -1.300 1.5e-06
atypical teratoid / rhabdoid tumor -1.400 6.2e-07
medulloblastoma, large-cell -2.000 2.0e-06
non-small cell lung cancer -1.356 5.8e-16
intraductal papillary-mucinous neoplasm ... -1.900 4.1e-03
colon cancer 1.800 4.4e-02
lung cancer -1.200 1.3e-03
lung adenocarcinoma -1.700 7.7e-16
pediatric high grade glioma -1.300 1.1e-03
psoriasis -1.300 5.0e-10
invasive ductal carcinoma -1.200 5.8e-03
ovarian cancer -1.600 6.4e-10

Gene RIF (4)

PMID Text
24587596 Rapamycin may prohibit sestrin1 downregulation through targeting mTORC2 in appeasing low shear stress induced EC oxidative apoptosis
20800603 Observational study of gene-disease association. (HuGE Navigator)
15105503 results show that sestrins, a family of proteins whose expression is modulated by p53, are required for regeneration of peroxiredoxins containing Cys-SO(2)H
12607115 PA26 mutations are an infrequent cause of heterotaxia (situs inversus) in humans.

AA Sequence

MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHAL      1 - 70
FADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVND     71 - 140
FLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAELVHAVVLLTHYH    141 - 210
SLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKM    211 - 280
RQLQECRDEEEASQEEMASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFR    281 - 350
VQDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDY    351 - 420
DYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRY    421 - 490
MT                                                                        491 - 492
//

Text Mined References (23)

PMID Year Title
26449471 2016 Sestrin2 is a leucine sensor for the mTORC1 pathway.
25263562 2014 The Sestrins interact with GATOR2 to negatively regulate the amino-acid-sensing pathway upstream of mTORC1.
25259925 2014 Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.
24587596 2014 Rapamycin attenuates endothelial apoptosis induced by low shear stress via mTOR and sestrin1 related redox regulation.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23274085 2013 Sestrins activate Nrf2 by promoting p62-dependent autophagic degradation of Keap1 and prevent oxidative liver damage.
21067298 2011 Gene expression following ionising radiation: identification of biomarkers for dose estimation and prediction of individual response.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19704005 2009 Regulation of protein synthesis by ionizing radiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18703169 2008 Suppressed expression of non-DSB repair genes inhibits gamma-radiation-induced cytogenetic repair and cell cycle arrest.
18692468 2008 p53 target genes sestrin1 and sestrin2 connect genotoxic stress and mTOR signaling.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16751804 2006 Identification of genes targeted by the androgen and PKA signaling pathways in prostate cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15105503 2004 Regeneration of peroxiredoxins by p53-regulated sestrins, homologs of bacterial AhpD.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12607115 2003 PA26 is a candidate gene for heterotaxia in humans: identification of a novel PA26-related gene family in human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9926927 1999 PA26, a novel target of the p53 tumor suppressor and member of the GADD family of DNA damage and growth arrest inducible genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7938006 1994 Gene regulation by temperature-sensitive p53 mutants: identification of p53 response genes.