Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.07
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
interstitial lung disease -2.000 1.7e-02
astrocytic glioma -3.700 5.2e-04
ependymoma -3.800 6.5e-04
oligodendroglioma -3.500 1.0e-03
glioblastoma -4.000 2.3e-05
medulloblastoma -4.300 1.5e-07
atypical teratoid / rhabdoid tumor -3.000 1.5e-03
medulloblastoma, large-cell -4.200 2.3e-03
primitive neuroectodermal tumor -3.600 1.6e-03
non-small cell lung cancer -2.220 1.5e-19
lung adenocarcinoma -1.500 3.7e-21
pediatric high grade glioma -3.100 3.0e-04
pilocytic astrocytoma -3.400 4.2e-05
psoriasis -2.500 1.6e-31
lung carcinoma -1.200 4.1e-10
Pick disease -1.700 5.5e-03
ovarian cancer -6.300 7.7e-13

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNII      1 - 70
SSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS                                      71 - 107
//

Text Mined References (6)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.