Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
cystic fibrosis 1670 2.0e-05
inflammatory breast cancer 404 2.9e-03

Expression

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSARPSLPPLPAKPAGSPRLRERPAPVGPGGEDAYSLLLRPQLGTRKVARAEEAGGEEGKREAEAWTRRA      1 - 70
AASARRGGELRTEEPPPPAARLCCLGGGCGGGGGGGQKVSATASIPFSCKRALLTSTIPLSPPAKRRGIR     71 - 140
TWGHPSYLTPSPTMRD                                                          141 - 156
//

Text Mined References (4)

PMID Year Title
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.