Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.48
PubTator Score 6.57

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.268 4.0e-02
Multiple myeloma 1.173 3.8e-02
malignant mesothelioma 1.100 1.2e-06
osteosarcoma -1.595 1.4e-03
astrocytoma 1.100 3.7e-02
juvenile dermatomyositis 1.147 2.2e-11
spina bifida -1.392 3.6e-02
acute myeloid leukemia 1.200 3.3e-03
ovarian cancer 1.700 7.8e-05
pituitary cancer -1.200 1.3e-03

Synonym

Accession Q14140 Q53TS2
Symbols Sei-2
TRIP-Br2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
23291629 TRIP-Br2, modulates fat storage through simultaneous regulation of lipolysis, thermogenesis and oxidative metabolism.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19152710 TRIP-Br2 is frequently overexpressed in both cancer cell lines and multiple human tumors.
18316374 CRM1-mediated nuclear export may be required for the proper execution of ubiquitin-proteasome-dependent degradation of TRIP-Br2

AA Sequence

MLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLR      1 - 70
RIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGSTTPLEACLTPASLLEDDD     71 - 140
DTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDG    141 - 210
PQESRADDSKLMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLL    211 - 280
KTLAPYSSQPVTPSQPFKMDLTELDHIMEVLVGS                                        281 - 314
//

Text Mined References (12)

PMID Year Title
23291629 2013 Ablation of TRIP-Br2, a regulator of fat lipolysis, thermogenesis and oxidative metabolism, prevents diet-induced obesity and insulin resistance.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19152710 2009 TRIP-Br2 promotes oncogenesis in nude mice and is frequently overexpressed in multiple human tumors.
18316374 2008 CRM1-mediated nuclear export is required for 26 S proteasome-dependent degradation of the TRIP-Br2 proto-oncoprotein.
16098148 2005 SEI family of nuclear factors regulates p53-dependent transcriptional activation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331592 2001 TRIP-Br: a novel family of PHD zinc finger- and bromodomain-interacting proteins that regulate the transcriptional activity of E2F-1/DP-1.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.