Property Summary

NCBI Gene PubMed Count 246
PubMed Score 127.85
PubTator Score 244.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 1.400 3.0e-05
astrocytic glioma -2.000 3.0e-03
ependymoma -2.600 1.1e-03
oligodendroglioma -1.900 1.0e-02
chronic lymphosyte leukemia 1.500 2.8e-05
cystic fibrosis 2.508 3.8e-07
glioblastoma 1.200 3.4e-02
primitive neuroectodermal tumor -2.100 7.4e-04
adrenocortical carcinoma -1.886 1.2e-02
pancreatic ductal adenocarcinoma liver m... -2.555 7.1e-03
intraductal papillary-mucinous adenoma (... -3.800 9.2e-05
intraductal papillary-mucinous carcinoma... -4.400 9.3e-05
intraductal papillary-mucinous neoplasm ... -3.400 1.2e-02
lung cancer -1.700 6.4e-05
fibroadenoma -1.800 2.6e-03
lung carcinoma -1.700 7.2e-05
gastric carcinoma 1.700 8.1e-03
ductal carcinoma in situ -1.200 2.2e-02
invasive ductal carcinoma -1.600 1.9e-03
ulcerative colitis 2.100 3.8e-04
ovarian cancer 3.000 5.1e-05
pancreatic cancer 2.400 5.1e-05

 IMPC Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (213)

PMID Text
26966066 We conclude that under OGD condition, PEDF and 44mer reduce H9c2 cells apoptosis and inhibit OGD-induced oxidative stress via its receptor PEDF-R and the PPARgamma signaling pathway.
26746675 Study discuss the anti-tumor activities of PEDF and focus on its dual role as an inhibitor (e.g., angiogenesis) and as an inducer of various vital biological processes that lead to the therapeutic effect via different mechanisms of action. [review]
26700654 Study demonstrated the inhibitory effect of PEDF on insulin-dependent molecular mechanisms of glucose homeostasis, and suggests that PEDF could be a specific target in the management of metabolic disorders.
26697494 We showed that transplantation of pigment epithelial cells overexpressing PEDF can restore a permissive subretinal environment for RPE and photoreceptor maintenance, while inhibiting choroidal blood vessel growth.
26612427 hCG-induced PEDF downregulation and VEGF upregulation are mediated by similar signaling cascades emphasizes the delicate regulation of ovarian angiogenesis.
26450919 We demonstrate that rPEDF may serve as a useful intervention to alleviate the risk of tamoxifen-induced endometrial pathologies
26427478 Studies indicate that pigment epithelium-derived factor (PEDF) is a natural protein of the retina .
26333415 Thus PEDF could be involved in the establishment of the avascular nature of seminiferous tubules and after puberty androgens may further reinforce this feature.
26308290 Data suggest differences in regulation of expression of PEDF (up-regulation) vs. VEGF (down-regulation) in granulosa cells explain reduced risk of ovarian hyperstimulation syndrome due to ovulation induction using GnRH/GNRHR agonists rather than hCG.
26304116 region composed of positions 98-114 of PEDF contains critical residues for PEDF-R interaction that mediates survival effects, the findings reveal distinct small PEDF fragments with neurotrophic effects on photoreceptors
25992628 PEDF sustained glioma stem cell self-renewal by Notch1 cleavage.
25948043 PEDF binds VEGFR-1 and VEGFR-2 in vascular endothelial cells.
25881671 Studies indicate that role of pigment epithelium-derived factor (PEDF) in diabetic and hypoxia-induced angiogenesis, and the pathways mediating PEDF's effects under these conditions.
25868797 MC3T3-E1 osteoblasts stably overexpressing SERPINF1 with the p.Ala91_Ser93dup mutation had decreased collagen type I deposition and mineralization
25844034 Elevated PEDF levels may be involved in promoting the development of COPD by performing proinflammatory functions.
25821324 Retinal pigment epithelial cells exposed to adiponectin showed decreased expression of VEGF mRNA, protein whereas PEDF protein is unaltered and PEDF mRNA was increased.
25820866 the results suggest that PEDF is not a major susceptibility gene for age-related macular degeneration (AMD) and polypoidal choroidal vasculopathy (PCV) in the overall population.
25705004 Serum PEDF levels were one of the independent correlates of circulating DPP-4 levels in cardiovascular disease patients.
25700221 Data suggest that pigment epithelium-derived factor (PEDF) and adipose triglyceride lipase (ATGL) may serve as therapeutic targets for managing vascular hyperpermeability in sepsis.
25678686 PEDF peptide derivative may be an innovative strategy for tissue engineering and repair therapy in partial LSC deficiency diseases.
25562624 PEDF inhibits retinal microvascular dysfunction induced by 12/15-lipoxygenase-derived eicosanoids.
25462587 The review discuss the evolving role of PEDF as a novel metabolic regulatory protein that plays a causal role in insulin resistance probably through proposed mechanism as inflammation, lipolytic free fatty acid mobilization or mitochondrial dysfunction.
25450390 PEDF is anti-angiogenic and is associated with the growth inhibition of hemangioma-derived endothelial cells.
25447045 MITF-regulated PEDF has a role in melanoma progression
25363869 pigment epithelium derived factor may regulate Sost expression by osteocytes leading to enhanced osteoblastic differentiation and increased matrix mineralization
25293868 plasma PEDF similar in type 2 diabetes mellitus and obese groups of children
25284724 PEDF inhibited breast cancer cell migration and invasion by down-regulating fibronectin
25172543 study supports the possible influence of sICAM-1 and PEDF on the pathophysiology of retinal neovascularization in SCD patients.
25166721 Elevated PEDF levels may represent a compensatory change in type 2 diabetic patients with renal disease and appear to be a useful marker for evaluating the progression of diabetic nephropathies.
25159325 Data suggest that healthy adult stem cells exposed to vitreous/aqueous humors of subjects with proliferative diabetic retinopathy results in increased expression of serpin F1, CXCL4 (platelet factor 4), and endothelin-1 (aqueous only).
25127091 Heterozygous SERPINF1 mutation carriers had no detectable abnormalities in fat and bone, despite decreased PEDF expression.
25064413 PEDF represents a novel intrinsic antioxidant of granulosa cells.
25030625 these results identify PEDF as a novel transcriptional target of MITF and support a relevant functional role for the MITF-PEDF axis in the biology of melanoma.
24810046 Suggest that PEDF/low-dose chemotherapy may represent a new therapeutic alternative for castration-refractory prostate cancer.
24769282 The expression levels of PEDF are inversely correlated to that of vascular endothelial growth factor during the menstrual cycle.
24766673 TFAP2B overexpression contributes to tumor growth and a poor prognosis of human lung adenocarcinoma through modulation of ERK and VEGF/PEDF signaling.
24760990 Data (including data from transgenic mice expressing human PEDF) suggest white adipose tissue exhibits near-normal angiogenesis/growth (adiposity)/lipid metabolism/insulin sensitivity in response to mild PEDF overexpression (as seen in obesity).
24698153 PEDF may play a pivotal role in skin homoeostasis and the response of keratinocytes to injury or inflammatory insults.
24361362 PEDF is emerging as an ovarian factor, which has unexpected reactive oxygen species (ROS)-augmenting activities in the human ovary; it may be involved in ovarian ROS homeostasis and may contribute to oxidative stress
24342618 PEDF causes anti-angiogenic, anti-inflammatory and anti-thrombogenic reactions in myeloma cells through the interaction with LR.
24255038 iPS-RPE possesses the machinery to process retinoids for support of visual pigment regeneration. Inhibition of all-trans retinyl ester accumulation by NEM confirms LRAT is active in iPS-RPE.
24161393 the present study suggests that atheroprotective effects of PEDF might be partly ascribed to its caveolin-1-interacting properties.
24105071 serum PEDF levels are closely associated with hs-CRP in women with PCOS. PEDF may play a role in the development of chronic inflammation in PCOS
24078214 Loss of PEDF expression is associated with malignant peripheral nerve sheath tumours.
23939834 PEDF activated ERK and AKT signaling pathways in MSCs to induce expression of osteoblastic-related genes. These data suggest that PEDF is involved in MSCs osteoblastic differentiation.
23924722 Here, PEDF was purified from human plasma by use of a dermatan sulfate affinity column, and then hydroxyapatite, gel filtration and ion exchange columns
23844817 This review discusses the role of PEDF in cardiometabolic disorders and the utility of measuring its levels.
23818523 PEDF-R is required for the survival and antiapoptotic effects of PEDF on retina cells.
23722394 We demonstrated a marginal association of the PEDF SNP, rs12603825, with myopic CNV in extremely myopic patients
23600479 Data suggest that serum PEDF (pigment epithelium-derived factor) is positively associated with insulin resistance and negatively associated with HDL level in prediabetes (impaired fasting glucose), diabetes type 2, and control subjects.
23569025 PEDF may be involved in the pathogenesis of condyloma acuminatum.
23553951 PEDF stimulated limbal stem cell proliferation.
23547730 Serum PEDF levels are positively associated with coronary artery disease in a Chinese population.
23547472 Only full length PEDF was shown to form amyloid like fibril structures, but not the truncated form. Accumulation of fibrils results in fibroblasts destruction and might be the cause of changes in structure of Tenon's capsule observed in myopia
23393224 Our data showed that the elevated AZGP1 and decreased PEDF and PRDX2 expressions in CRC serum and tissues were correlated with liver metastases.
23359450 PEDF suppression of oxidative stress delays cellular senescence and allows greater expansion of mesenchymal stem cells.
23346798 Dry form of age related retinal degeneration was associated with lower plasma PEDF levels. A strong positive correlation between VEGF and PEDF concentrations was seen in patients with wet form and in patients with bilateral disease.
23318725 Liver, but not adipose tissue, might be the source of increased circulating PEDF linked to insulin resistance.
23218576 Circulating levels of PEDF were independently associated with asymmetrical dimethylarginine levels.
23151593 PEDF silencing confers resistance to tamoxifen in breast cancer cells and its stable expression sensitizes resistant cells to endocrine therapy
23123582 Adenovirus mediated PEDF is potent in retarding the growth and invasiveness of endometrial cancer cells.
23075882 the dynamic expression of PEDF that inversely portrays VEGF expression may imply its putative role as a physiological negative regulator of follicular angiogenesis.
23055574 Increased levels of PEDF may be a response to counterbalance the activity of angiogenic and fibrogenic factors in proliferative diabetic retinopathy (PDR), proliferative vitreoretinopathy (PVR).
23038613 PEDF acts directly on monocytes/macrophages by inducing their migration and differentiation into M1-type cells in prostate.
22930782 Plasma PEDF is elevated in overweight youth and is positively associated with insulin resistance. These findings suggest that PEDF may play a role in the development of cardiometabolic dysfunction in youth.
22917444 these data validate that MSCs-PEDF can migrate and deliver PEDF to target glioma cells, which may be a novel and promising therapeutic approach for refractory brain tumour.
22915824 Adenoviral E4 region stimulated expression and secretion of PEDF by human renal epithelial cells that acted as a survival factor for glomerulus-derived endothelial cells.
22884488 The present study reveals that serum levels of PEDF are independently associated with P-III-P levels, suggesting that PEDF level is a novel biomarker of liver fibrosis in patients with nonalcoholic fatty liver disease.
22837306 Data suggest that patients exhibit elevated circulating PEDF in obesity, hypertension, dyslipidemia, and insulin resistance compared with subjects with normal glucose tolerance. Plasma PEDF might be useful biomarker for atherosclerosis.
22827961 Serum levels of PEDF are independently associated with fasting apoB48 levels in carotid atherosclerosis.
22819570 Data suggest that down-regulation of PEDF expression and increased microvascular density in ovarian endometriotic lesions play roles in pathogenesis of ovarian endometriosis; lesions were compared to endometrium from patients and control subjects.
22792709 PEDF (44-77) suppressed proliferation of endothelial cells by 53% and inhibited endothelial cell tube formation at the concentration of 1 nM.
22701300 The differential effects exhibited by StVOrth-2 and StVOrth-3 in this orthotopic model of osteosarcoma may be related to the functional epitopes on the PEDF glycoprotein that they represent.
22669302 results suggest that lack of circulating PEDF is a common characteristic of osteogenesis imperfecta type VI, regardless of the nature of the underlying SERPINF1 mutation
22570532 This paper highlights the current understanding of probable mechanism of how PEDF blocks deterioration of diabetic retinopathy through its antioxidative properties and application prospects of PEDF as a novel therapeutic target in diabetic retinopathy.
22547925 Show that long-term survival and neurotrophic potential of hRPE cells can be enhanced by FDA-approved plastic-based microcarriers. Growth of hRPE cells on microcarriers led to sustained levels of PEDF and VEGF-A in conditioned media for two months.
22457810 functional common genetic variant in the gene locus encoding PEDF contributes to overall body adiposity, obesity-related insulin resistance, and circulating leptin levels
22457728 findings show that hypoxic conditions encountered during primary melanoma growth downregulate antiangiogenic and antimetastasic PEDF by a posttranslational mechanism involving degradation by autophagy
22315956 PEDF processing is associated with coronary plaque rupture.
22234980 In patients with pancreatic ductal adenocarcinoma, both tissue and serum levels of PEDF were decreased, stromal TIP47 expression was higher and the tissue VEGF to PEDF ratio was increased.
22218393 Results indicate that adeno-associated virus-mediated PEDF gene expression may offer an active approach to inhibit Lewis lung carcinoma growth.
22215693 findings establish PEDF as both a metastatic suppressor and a neuroprotectant in the brain, highlighting its role as a double agent in limiting brain metastasis and its local consequences
22120651 elevated sera levels in psoriasis patients
22115973 MITF acts through PEDF to inhibit RPE cell migration and to play a significant role in regulating RPE cellular function.
22113968 the patients are homozygous for a frameshift mutation in exon 4 of the SERPINF1 gene, which leads to lack of the transcription/translation product, likely a key factor in bone deposition and remodeling
22051848 Lower levels of serum PEDF were found in women with endometriosis than in those without endometriosis.
22029535 No evidence was found to support a role for the Met72Thr variant in susceptibility to either PCV or nAMD in a Han Chinese cohort.
22028839 a novel nuclear localization signal and mechanism for serpinF1 nuclear import
21947986 PEDF may play a role in renal dysfunction in coronary artery disease patients.
21851923 We found that ficolin-3 levels were elevated in the vitreous fluid of patients with proliferative diabetic retinopathy (PDR); and may be used as a new therapeutic target for treatment of PDR.
21846721 a novel mechanism for the tumoricidal activity of PEDF, which involves tumor cell killing via PPARgamma-mediated TRAIL induction in macrophages.
21826736 Loss of pigment epithelium-derived factor function constitutes a novel mechanism for osteogenesis imperfecta and shows its involvement in bone. mineralization.
21777264 Data suggest that plasma PEDF concentration is significantly associated with BP, and incident hypertension.
21697716 may be involved in cross talk between adipose tissue and skeletal muscle [review]
21673604 PEDF modulated diverse categories of genes known to be involved in angiogenesis and migration in human melanoma cells.
21652703 Pigment epithelium-derived factor (PEDF) shares binding sites in collagen with heparin/heparan sulfate proteoglycans.
21570865 Data show that PEDF inhibits the production of IL8 in human hormone-refractory prostate cancer cells, through PEDF receptor/phospholipase A2 regulation of NFkappaB and PPARgamma, and delays the growth of these cells in vitro.
21353196 These data provide genetic evidence for SERPINF1 involvement in human bone homeostasis.
21336718 PEDF expression had a negative correlation with IL-8 in papillary urothelial neoplasm of low malignant potential.
21330424 PEDF may be a useful biomarker for assessing the effects of angiotensin II type 1 receptor blockers independent of a reduction in blood pressure.
21323605 The combined assessment of pigment epithelium-derived factor (PEDF), Haptoglobin and Tau protein levels, using Iterative Marginal Optimization, improved the differential diagnosis of Alzheimer's Disease and other dementias.
21292512 Expressional change of PEDF and TNF-alpha is in relation to angiogenesis of bladder tumor
21281801 Overexpression of PEDF inhibits retinal inflammation and neovascularization.
21275514 VEGF and PEDF may independently influence retinal vascular permeability in CRVO patients with macular edema.
21236558 Data indicate that bone marrow stem cells play an important role in regulating neovascularization, and that the ratio of VEGF and PEDF may be an indicator of the pro- or anti-angiogenic activities of BMSCs.
21211310 The expression of PEDF and the incidence of prostate cancer have a negative correlation.
21209034 The serum PEDF level is elevated in women with polycystic ovary syndrome and is associated with insulin resistance
21174599 Detection of SNPs in the PEDF gene was not found to be significantly associated with exudative age-related macular degeneration.
21152082 Studies indicate that preferred codon usage is advantageous to translational efficiency of biologically active PEDF in E coli.
21122834 Significantly lower levels of peritoneal fluid PEDF in patients with endometriosis compared with patients without endometriosis, suggest that peritoneal fluid PEDF plays a role in the pathogenesis of this disorder.
21067572 Observational study of gene-disease association. (HuGE Navigator)
21059648 reveal the molecular signaling mechanism by which the phosphorylated PEDF exerts its stronger antiangiogenic, antitumor activities.
21058962 Three-step serum proteome analysis reveals that excessive alcohol drinking increases the PEDF level
20857208 These results indicate that PEDF may play an inhibitory role on growth and migration of HaCaT cells through dephosphorylation of ERK1/2.
20709803 Reduced pigment epithelium-derived factor is associated with liver cirrhosis and fibrosis.
20685859 Plasma PEDF was significantly associated with the presence of the metabolic syndrome and predicted the development of the metabolic syndrome in Chinese men.
20678803 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20664971 PEDF gene loaded in PLGA nanoparticles could effectively inhibit the growth of mouse colonic carcinoma.
20631025 PEDF concentrations decrease significantly after weight loss in association with blood pressure. PEDF seems to be involved in human adipocyte biology.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20504225 55% lower plasma level of PEDF in colorectal cancer patients than in a healthy control group.
20504225 Observational study of gene-disease association. (HuGE Navigator)
20412062 Size-exclusion ultrafiltration assays showed that recombinant human PEDF formed a complex with recombinant yeast F(1)-ATP synthase.
20381502 Our present study suggests that substitution of PEDF proteins may be a promising strategy for the treatment of diabetic nephropathy.
20237999 The results suggest a molecular pathway by which PEDF ligand/receptor interactions on the cell surface could generate a cellular signal.
20229034 PEDF expression is a potentially useful prognostic marker for breast cancer survival.
20228934 polarity is an important determinant of the level of PEDF and VEGF secretion in pigment epithelial cells
20141354 Our results suggest lack of association of PRKCB1 gene promoter polymorphisms and moderate protective association of PEDF gene polymorphism with diabetic retinopathy in the south Indian population.
20132989 Gene variants in both CFH and HTRA1 contribute significantly to the AMD (age-related macular degeneration) phenotype in a Japanese population.
20104255 Decreased expression of PEDF in primary human lens epithelial cells resulted in a decrease in the expression of vimentin and the increase of alphaB-crystallin expression, two proteins critical for maintaining lens clarity.
20087951 Data suggests serum pigment epithelium derived factor (PEDF) is an independent marker of metabolic syndrome in a Caucasian population.
19948828 PEDF may exert anti-apoptotic effects through inhibition of lysosomal degradation of Bcl-xL in camptothecin-treated HepG2 cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19661223 Lentivirus-mediated gene transfer of PEDF decreased the growth of ocular melanoma and its hepatic micrometastasis in a mouse ocular melanoma model.
19637042 Decreased PEDF expression contributes to tumor progression, possibly through increased tumor cell proliferation and increased angiogenesis.
19635565 Serum PEDF levels may be elevated in response to circulating advanced glycation end products(AGEs) as a counter-system against the AGE-elicited tissue damage.
19608741 NCoR1 expression is required to maintain IEC in a proliferative state, and PEDF is a novel transcriptional target for NCoR1 repressive action
19583952 The pigment epithelium-derived factor is a negative regulator of insulin action in obesity.
19513563 Showed that reduced PEDF levels in lung cancer tissues significantly correlated with lymph node metastasis and an overall poor prognosis in the lung cancer patients.
19503741 Genotyped the Met72Thr variant (rs1136287) and report a lack of association between the PEDF Met72Thr variant and either neovascular age-related macular degeneration (AMD) or polypoidal choroidal vasculopathy (PCV) in a Japanese population.
19503741 Observational study of gene-disease association. (HuGE Navigator)
19342598 Late outgrowth endothelial cells derived from Wharton jelly in human umbilical cord reduce neointimal formation after vascular injury: involvement of pigment epithelium-derived factor.
19298519 Data suggest a role for PEDF in the regulation of angiogenesis in the heart and propose PEDF as a possible therapeutic target in heart disease.
19253105 The reduction in PEDF expression levels may be, in part, responsible for tumor malignancy in VEGF-low ovarian tumors
19247457 Transduced PEDF reduces retinal ganglion cell(RGC) loss and vision decline in DBA/2J mice, possibly via reduction of TNF and IL-18, and downregulation of GFAP. Novel approach to prevention of glaucomatous RGC death.
19224861 Results suggest that the laminin receptor is a pigment epithelium-derived factor (PEDF)receptor that mediates PEDF angiogenesis inhibition.
19223990 data suggest that none of the investigated PEDF polymorphisms is likely a major risk factor for exudative age-related macular degeneration in a white European population
19223990 Observational study of gene-disease association. (HuGE Navigator)
19182495 study found a difference in protein levels of expression of VEGF and PEDF between diabetic and non-diabetic epiretinal membranes
19180572 review summarizes the current knowledge on the biochemical properties of PEDF and its receptors and the therapeutic potential of PEDF
19091957 Cytosolic phospholipase A2-alpha is an early apoptotic activator in PEDF-induced endothelial cell apoptosis.
18845835 An apoptosis-inducing factor (AIF)-related pathway is an essential target of PEDF-mediated neuroprotection.
18805795 The HA-binding activity of PEDF may contribute to deposition in the extracellular matrix and to its reported antitumor/antimetastatic effects.
18792873 PEDF could improve the Advanced glycation end products-elicited insulin resistance in Hep3B cells by inhibiting JNK- and IkappaB kinase-dependent serine phosphorylation of IRS-1 via suppression of Rac-1 activation.
18787502 Observational study of gene-disease association. (HuGE Navigator)
18787046 Plasma SERPINF1 level is strongly associated with body adiposity, especially with the visceral fat depot in the non-diabetic general population.
18715664 Data show that serum PEDF levels (mean (S.D.)) were increased in 96 Type 2 diabetic vs. 54 non-diabetic subjects.
18704312 HIF-1alpha-specific shRNA can effectively silence the HIF-1alpha gene, and consequently down-regulate VEGF and up-regulate PEDF expression in retinal pigment epithelial cells under hypoxic conditions.
18677713 Serum levels of PEDF were positively associated with metabolic components and TNF-alpha in Japanese patients with type 2 diabetes.
18676622 In moderate hypoxia, PEDF is downregulated such that the VEGF-to-PEDF ratio increases (and angiogenesis is facilitated).
18625531 serum level of PEDF was one of the independent determinants of resting heart rate in Japanese outpatients
18523656 The levels of plasma PEDF increases with advances in both diabetic retinopathy and nephropathy.
18455830 PEDF levels are significantly higher in type 1 diabetic patients with retinopathy compared to the patients without it.
18312852 These results give the first direct demonstration that PEDF might represent a target for PARP inhibition treatment and the effects of PEDF on endothelial cells growth are context dependent.
18226801 Our data suggest that the PEDF Met72Thr T allele may be a risk factor for wet AMD in the Taiwan Chinese population. PEDF may play a role in the pathogenesis of wet AMD.
18226801 Observational study of gene-disease association. (HuGE Navigator)
18191271 There is a novel role for PEDF in hepatic triglyceride homeostasis through binding to ATGL. Both localize to adiposomes in hepatocytes.
18180304 GPR39 protects from cell death by increasing secretion of pigment epithelium-derived growth factor
18084848 Results demonstrate that the aqueous humour level of asymmetric dimethylarginine is correlated with pigment epithelium-derived factor in humans and suggest that both ADMA and PEDF may be elevated in response to inflammation in uveitis.
17870167 PEDF induces macrophage apoptosis and necrosis through the signaling of PPARgamma.
17658465 These results demonstrate that the PEDF gene, in cooperation with the VEGF gene, may contribute to the development of diabetic retinopathy.
17651710 PEDF induces human umbilical vein endothelial cells apoptosis through the sequential induction of PPARgamma and p53 overexpression.
17604022 The correlation between PEDF and VEGF striatal levels in PD patients suggests that concerted neurotrophic functions of these factors or structural changes in blood vessel walls play an important role in the pathophysiology of PD.
17593873 hepatic PEDF levels may be elevated to counteract the effects of oxidative stress
17525281 These results demonstrate that PEDF could inhibit neointimal formation via suppression of NADPH oxidase-mediated reactive oxygen species generation.
17479108 PEDF-overexpressing tumors exhibited reduced intratumoral angiogenesis, and PEDF may be a new and promising approach for the treatment of osteosarcoma.
17213275 High levels of PEDF in the plasma may be related to the progression of diabetic retinopathy.
17202143 heparin induces a conformational change in the vicinity of Lys(178)
17188371 Increase in serum PEDF during ulcerative colitis, especially in severe forms of disease suggests its involvement in ulcerative colitis pathogenesis.
16896539 The analysis of the promoter region of the EPC-1/PEDF gene in this paper suggests the age- and cell cycle-dependent expression of specific transcriptional factor(s).
16797605 PEDF may play a protective role against early diabetic retinopathy by attenuating the deleterious effect of AGE
16777976 study is the first to demonstrate a role of pigment epithelium-derived factor (PEDF) in ovarian surface epithelium biology and ovarian cancer and suggests that the loss of PEDF may be of relevance in carcinogenesis
16740777 These observations collectively support the hypothesis that a lack of PEDF expression is a potent factor for the enhancement of tumor growth and angiogenesis in breast cancer.
16707486 Central mechanism for PEDF inhibition of the AGE signaling to vascular permeability is by suppression of NADPH oxidase-mediated reactive oxygen species generation and subsequent VEGF expression.
16596284 Results show that low levels of PEDF in lung tumor tissues was associated with a significantly shorter survival.
16409998 REVIEW: this paper describes the unbalanced expressions of VEGF and PEDF as a cause of CNV
16322471 Phosphorylation induces variable effects of PEDF, and therefore contributes to the complexity of PEDF action, shich might be used to generate effective antiangiogenic or neurotrophic drugs.
16196102 In painless neuropathies, there is decreased level of PEDF in cerebrospinl fluid, compared with patients with painful neuropathies.
16102727 In tumor xenografts, the overexpression of wild-type PEDF significantly suppressed tumor growth, whereas a mutant of the collagen I-binding site of PEDF (Col-mut PEDF) did not inhibit tumor growth
15994443 PEDF may play a significant role in determining the balance of angiogenesis/ antiangiogenesis during atherogenesis
15856012 PEDF gene contains a response element specific for p63 and p73 in its promoter region
15846509 PEDF inhibits Ang-II-induced EC activation by suppressing NADPH-oxidase-mediated ROS generation and that PEDF may play a protective role in the development
15713745 PEDF downregulates Fyn through Fes, resulting in inhibition of FGF-2-induced capillary morphogenesis of endothelial cells
15377265 PEDF-6 affects different second messenger biosynthesis systems in HL-60 cells. and inhibits phosphatidylinositol-specific phospholipase C stimulated by aluminum tetrafluoride anions
15374885 novel role of extracellular phosphorylation is shown here to completely change the nature of PEDF from a neutrophic to an antiangiogenic factor.
15239109 Role in angiogenesis of hepatocellular carcinoma(HCC). Reduction of serum PEDF concentration associated with development of chronic liver diseases may contribute to progression of HCC. Gene therapy using PEDF may be efficient treatment for HCC.
15150108 PEDF expression suggests a more favorable prognosis than in patients with ductal pancreatic adenocarcinomas.
15140209 potential role of the age-associated decline in EPC-1 expression in tissue remodeling and in the development of skin diseases with excessive angiogenesis
15096582 effectively abates vascular endothelial growth factor-induced vascular permeability
14991838 Malignant peripheral nerve sheath tumors (MPNST) Schwann cells lose the ability to downregulate PEDF upon axonal contact.
12920663 level of the natural ocular anti-angiogenic agent pigment epithelium-derived factor (PEDF) is inversely associated with proliferative retinopathy
12878936 Gene transfer of pigment epithelium-derived factor suppresses tumor vascularization and growth, while prolonging survival in syngeneic murine models of thoracic malignancies.
12860293 human oral squamous cell carcinoma cells produce VEGF, which in turn regulates PEDF production, and this balance may be contributing to neovascularization in tumors.
12837042 Observational study of gene-disease association. (HuGE Navigator)
12827055 Pterygia exhibit significantly lower PEDF but higher VEGF levels than those in normal corneas and conjunctivae. The decreased PEDF level in pterygia may play a role in the formation and progression of pterygia.
12737624 Present in plasma at approx. 100 nM (5 microg/ml) or twice the level required to inhibit aberrant blood-vessel growth in the eye
12711260 PEDF may block the angiogenic effects of leptin through its anti-oxidative properties
12687338 pigment epithelium-derived factor content in the aqueous humor of diabetic patients strongly predicts who among them will develop progression of retinopathy
12670505 VEGF secreted by retinal pigment epithelial cells upregulates pigment epithelium-derived factor expression via VEGFR-1 in an autocrine manner.
12603315 reactive center loop, specifically Gly376 and Leu377, is involved in the interaction of PEDF with components of the quality control system in the endoplasmic reticulum, thus ensuring its efficient secretion
12599204 EPC-1 may play a role in the entry of early passage fibroblasts into a G(0) state or the maintenance of such a state once reached
12237317 Results describe the first collagen-binding site described for a serpin, pigment epithelium-derived factor (PEDF), which is distinct from its heparin-binding region, neurotrophic active site, and its serpin exposed loop.
12200129 role of PEDF in protecting retinal pericytes from oxidant injury

AA Sequence

MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRS      1 - 70
STSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSAS     71 - 140
RIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGV    141 - 210
AHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPL    211 - 280
KVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKP    281 - 350
IKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP      351 - 418
//

Text Mined References (253)

PMID Year Title
27056980 2016 Mutations and altered expression of SERPINF1 in patients with familial otosclerosis.
26966066 2016 PEDF and PEDF-derived peptide 44mer inhibit oxygen-glucose deprivation-induced oxidative stress through upregulating PPAR? via PEDF-R in H9c2 cells.
26746675 2016 Anti-tumor effects of pigment epithelium-derived factor (PEDF): implication for cancer therapy. A mini-review.
26700654 2016 PEDF attenuates insulin-dependent molecular pathways of glucose homeostasis in skeletal myocytes.
26697494 2015 Antiangiogenic and Neurogenic Activities of Sleeping Beauty-Mediated PEDF-Transfected RPE Cells In Vitro and In Vivo.
26612427 2016 Pigment epithelium-derived factor regulation by human chorionic gonadotropin in granulosa cells.
26450919 2015 Pigment Epithelium-Derived Factor Alleviates Tamoxifen-Induced Endometrial Hyperplasia.
26427478 2016 Pigment Epithelium-Derived Factor, a Protective Factor for Photoreceptors in Vivo.
26333415 2015 Human testicular peritubular cells secrete pigment epithelium-derived factor (PEDF), which may be responsible for the avascularity of the seminiferous tubules.
26308290 2015 GnRH Agonist Triggering Modulates PEDF to VEGF Ratio Inversely to hCG in Granulosa Cells.
26304116 2015 Small Retinoprotective Peptides Reveal a Receptor-binding Region on Pigment Epithelium-derived Factor.
25992628 2015 Pigment Epithelium-Derived Factor (PEDF) Expression Induced by EGFRvIII Promotes Self-renewal and Tumor Progression of Glioma Stem Cells.
25948043 2015 Recombinant pigment epithelium-derived factor PEDF binds vascular endothelial growth factor receptors 1 and 2.
25881671 2015 PEDF and its roles in physiological and pathological conditions: implication in diabetic and hypoxia-induced angiogenic diseases.
25868797 2015 The effect of SERPINF1 in-frame mutations in osteogenesis imperfecta type VI.
25844034 2015 Elevated plasma levels of pigment epithelium-derived factor correlated with inflammation and lung function in COPD patients.
25821324 Effect of adiponectin on expression of vascular endothelial growth factor and pigment epithelium-derived factor: an in vitro study.
25820866 2015 Association of PEDF polymorphisms with age-related macular degeneration and polypoidal choroidal vasculopathy: a systematic review and meta-analysis.
25705004 2015 Serum levels of pigment epithelium-derived factor (PEDF) are inversely associated with circulating levels of dipeptidyl peptidase-4 (DPP-4) in humans.
25700221 2015 Pigment epithelium-derived factor regulates microvascular permeability through adipose triglyceride lipase in sepsis.
25678686 2015 Pigment Epithelial-Derived Factor Peptide Facilitates the Regeneration of a Functional Limbus in Rabbit Partial Limbal Deficiency.
25562624 2015 Pigment epithelium-derived factor inhibits retinal microvascular dysfunction induced by 12/15-lipoxygenase-derived eicosanoids.
25462587 2015 PEDF-induced alteration of metabolism leading to insulin resistance.
25450390 2014 Role of pigment epithelium-derived factor in the involution of hemangioma: autocrine growth inhibition of hemangioma-derived endothelial cells.
25447045 2015 A novel role for microphthalmia-associated transcription factor-regulated pigment epithelium-derived factor during melanoma progression.
25416956 2014 A proteome-scale map of the human interactome network.
25363869 2015 Pigment epithelium derived factor suppresses expression of Sost/Sclerostin by osteocytes: implication for its role in bone matrix mineralization.
25293868 2015 Elevated plasma pigment epithelium-derived factor in children with type 2 diabetes mellitus is attributable to obesity.
25284724 2014 Pigment epithelium-derived factor (PEDF) inhibits breast cancer metastasis by down-regulating fibronectin.
25172543 2015 Increased circulating PEDF and low sICAM-1 are associated with sickle cell retinopathy.
25166721 2014 Elevated circulating pigment epithelium-derived factor predicts the progression of diabetic nephropathy in patients with type 2 diabetes.
25159325 2014 Growth factors/chemokines in diabetic vitreous and aqueous alter the function of bone marrow-derived progenitor (CD34?) cells in humans.
25127091 2014 Normal bone density and fat mass in heterozygous SERPINF1 mutation carriers.
25064413 2014 Pigment epithelium-derived factor exerts antioxidative effects in granulosa cells.
25030625 2014 Regulatory and functional connection of microphthalmia-associated transcription factor and anti-metastatic pigment epithelium derived factor in melanoma.
24810046 2014 Pigment epithelium-derived factor expression prolongs survival and enhances the cytotoxicity of low-dose chemotherapy in castration-refractory prostate cancer.
24769282 2014 Hormonal regulation of pigment epithelium-derived factor (PEDF) expression in the endometrium.
24766673 2014 TFAP2B overexpression contributes to tumor growth and a poor prognosis of human lung adenocarcinoma through modulation of ERK and VEGF/PEDF signaling.
24760990 2014 Augmented expression and secretion of adipose-derived pigment epithelium-derived factor does not alter local angiogenesis or contribute to the development of systemic metabolic derangements.
24698153 2014 Production and function of pigment epithelium-derived factor in isolated skin keratinocytes.
24361362 2014 Pigment-Epithelium Derived Factor (PEDF) and the human ovary: a role in the generation of ROS in granulosa cells.
24342618 2014 Laminin receptor mediates anti-inflammatory and anti-thrombogenic effects of pigment epithelium-derived factor in myeloma cells.
24255038 2014 Retinoid uptake, processing, and secretion in human iPS-RPE support the visual cycle.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24161393 2013 Pigment epithelium-derived factor (PEDF) binds to caveolin-1 and inhibits the pro-inflammatory effects of caveolin-1 in endothelial cells.
24105071 2013 Association of serum pigment epithelium-derived factor with high-sensitivity C-reactive protein in women with polycystic ovary syndrome.
24078214 2013 Effects of pigment epithelium derived factor (PEDF) on malignant peripheral nerve sheath tumours (MPNSTs).
23939834 2013 Pigment epithelium-derived factor enhances differentiation and mineral deposition of human mesenchymal stem cells.
23924722 2013 Glycosaminoglycan and collagen facilitate the degradation of pigment epithelium-derived factor by chymotrypsin.
23844817 2014 Pigment epithelium-derived factor (PEDF) and cardiometabolic disorders.
23818523 2013 Pigment epithelium-derived factor (PEDF) prevents retinal cell death via PEDF Receptor (PEDF-R): identification of a functional ligand binding site.
23722394 2013 Evaluation of pigment epithelium-derived factor and complement factor I polymorphisms as a cause of choroidal neovascularization in highly myopic eyes.
23600479 2013 Associations between pigment epithelium-derived factor, insulin resistance and high density lipoprotein.
23569025 2013 Downregulation of pigment epithelium-derived factor in condyloma acuminatum.
23553951 2013 PEDF promotes self-renewal of limbal stem cell and accelerates corneal epithelial wound healing.
23547730 2013 Serum pigment epithelium-derived factor levels are independently correlated with the presence of coronary artery disease.
23547472 [Amyloid-like fibrils forming and fibroblasts destruction in Tenon's capsule in progressive myopia as a result of pigment epithelium derived factor resistance to restricted proteolysis].
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23393224 2013 Prognostic role of serum AZGP1, PEDF and PRDX2 in colorectal cancer patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23359450 2013 Pigment epithelium-derived factor delays cellular senescence of human mesenchymal stem cells in vitro by reducing oxidative stress.
23346798 2012 PEDF and VEGF plasma level alterations in patients with dry form of age-related degeneration--a possible link to the development of the disease.
23318725 2013 Liver, but not adipose tissue PEDF gene expression is associated with insulin resistance.
23218576 2013 Asymmetrical dimethylarginine level is independently associated with circulating levels of RAGE and PEDF.
23151593 2012 Loss of pigment epithelium-derived factor: a novel mechanism for the development of endocrine resistance in breast cancer.
23123582 2012 PEDF inhibits growth and invasiveness of endometrial cancer cells in vitro.
23075882 2013 Hormonal regulation of pigment epithelium-derived factor (PEDF) in granulosa cells.
23055574 2012 Osteopontin and other regulators of angiogenesis and fibrogenesis in the vitreous from patients with proliferative vitreoretinal disorders.
23054245 2012 Study of autosomal recessive osteogenesis imperfecta in Arabia reveals a novel locus defined by TMEM38B mutation.
23038613 2013 Positive correlation between PEDF expression levels and macrophage density in the human prostate.
22930782 2012 Pigment epithelium-derived factor (PEDF) varies with body composition and insulin resistance in healthy young people.
22917444 2013 Mesenchymal stem cells overexpressing PEDF decrease the angiogenesis of gliomas.
22915824 2012 Adenoviral E4 gene stimulates secretion of pigmental epithelium derived factor (PEDF) that maintains long-term survival of human glomerulus-derived endothelial cells.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22884488 2012 Serum levels of pigment epithelium-derived factor (PEDF) are independently associated with procollagen III N-terminal peptide levels in patients with nonalcoholic fatty liver disease.
22837306 2012 C1q/TNF-related protein-3 (CTRP-3) and pigment epithelium-derived factor (PEDF) concentrations in patients with type 2 diabetes and metabolic syndrome.
22827961 2012 Serum levels of pigment epithelium-derived factor, a novel marker of insulin resistance, are independently associated with fasting apolipoprotein B48 levels in humans.
22819570 2012 Decreased expression of pigment epithelium-derived factor and increased microvascular density in ovarian endometriotic lesions in women with endometriosis.
22792709 [Recombinant fragment of pigment epithelium-derived factor (44-77) prevents pathological corneal neovascularization].
22701300 2012 Efficacy of continuously administered PEDF-derived synthetic peptides against osteosarcoma growth and metastasis.
22669302 2012 Lack of circulating pigment epithelium-derived factor is a marker of osteogenesis imperfecta type VI.
22570532 2012 PEDF in diabetic retinopathy: a protective effect of oxidative stress.
22547925 2012 PEDF and VEGF-A output from human retinal pigment epithelial cells grown on novel microcarriers.
22457810 2012 Common genetic variation in the SERPINF1 locus determines overall adiposity, obesity-related insulin resistance, and circulating leptin levels.
22457728 2012 Hypoxia negatively regulates antimetastatic PEDF in melanoma cells by a hypoxia inducible factor-independent, autophagy dependent mechanism.
22315956 2012 Proteomic profiling of acute coronary thrombosis reveals a local decrease in pigment epithelium-derived factor in acute myocardial infarction.
22234980 2012 Concurrent PEDF deficiency and Kras mutation induce invasive pancreatic cancer and adipose-rich stroma in mice.
22218393 2012 AAV-mediated gene transfer of human pigment epithelium-derived factor inhibits Lewis lung carcinoma growth in mice.
22215693 2012 Opposing effects of pigment epithelium-derived factor on breast cancer cell versus neuronal survival: implication for brain metastasis and metastasis-induced brain damage.
22120651 2012 The role of pigment epithelium-derived factor as an adipokine in psoriasis.
22115973 2012 Microphthalmia-associated transcription factor acts through PEDF to regulate RPE cell migration.
22113968 2012 Lack of expression of SERPINF1, the gene coding for pigment epithelium-derived factor, causes progressively deforming osteogenesis imperfecta with normal type I collagen.
22051848 2012 Reduced levels of serum pigment epithelium-derived factor in women with endometriosis.
22029535 2012 Lack of association with PEDF Met72Thr variant in neovascular age-related macular degeneration and polypoidal choroidal vasculopathy in a Han Chinese population.
22028839 2011 Pigment epithelium-derived factor (PEDF) interacts with transportin SR2, and active nuclear import is facilitated by a novel nuclear localization motif.
22028381 2011 Quantitative detection of single amino acid polymorphisms by targeted proteomics.
21947986 2011 Association between plasma levels of pigment epithelium-derived factor and renal dysfunction in patients with coronary artery disease.
21851923 2011 Correlation between ficolin-3 and vascular endothelial growth factor-to-pigment epithelium-derived factor ratio in the vitreous of eyes with proliferative diabetic retinopathy.
21846721 2011 Pigment epithelium-derived factor (PEDF) promotes tumor cell death by inducing macrophage membrane tumor necrosis factor-related apoptosis-inducing ligand (TRAIL).
21826736 2011 Mutations in SERPINF1 cause osteogenesis imperfecta type VI.
21777264 2012 Plasma concentration of pigment epithelium-derived factor is closely associated with blood pressure and predicts incident hypertension in Chinese: a 10-year prospective study.
21697716 2011 Pigment epithelium-derived factor: a not so sympathetic regulator of insulin resistance?
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21673604 2011 Changes in the gene expression profile of A375 human melanoma cells induced by overexpression of multifunctional pigment epithelium-derived factor.
21652703 2011 Pigment epithelium-derived factor (PEDF) shares binding sites in collagen with heparin/heparan sulfate proteoglycans.
21570865 2011 PEDF inhibits IL8 production in prostate cancer cells through PEDF receptor/phospholipase A2 and regulation of NF?B and PPAR?.
21353196 2011 Exome sequencing identifies truncating mutations in human SERPINF1 in autosomal-recessive osteogenesis imperfecta.
21336718 2011 Expression of pigment epithelium-derived factor in bladder tumour is correlated with interleukin-8 yet not with interleukin-1?.
21330424 2011 Significance of pigment epithelium-derived factor levels with angiotensin II type 1 receptor blockers in patients with successful coronary stent implantation.
21323605 2011 Combined measurement of PEDF, haptoglobin and tau in cerebrospinal fluid improves the diagnostic discrimination between alzheimer's disease and other dementias.
21292512 2013 Expression of pigment epithelium-derived factor and tumor necrosis factor-? is correlated in bladder tumor and is related to tumor angiogenesis.
21281801 2011 Overexpression of pigment epithelium-derived factor inhibits retinal inflammation and neovascularization.
21275514 2011 Vitreous levels of pigment epithelium-derived factor and vascular endothelial growth factor in macular edema with central retinal vein occlusion.
21269460 2011 Initial characterization of the human central proteome.
21236558 2011 The ratio of VEGF/PEDF expression in bone marrow mesenchymal stem cells regulates neovascularization.
21211310 2010 [Inhibition and significance of pigment epithelium-derived factor in the development and metastasis of prostate cancer].
21209034 2011 Serum pigment epithelium-derived factor is elevated in women with polycystic ovary syndrome and correlates with insulin resistance.
21174599 2011 Pigment epithelium-derived factor gene polymorphisms in exudative age-related degeneration in a chinese cohort.
21152082 2010 Codon preference optimization increases heterologous PEDF expression.
21122834 2011 Decreased concentrations of pigment epithelium-derived factor in peritoneal fluid of patients with endometriosis.
21067572 2010 Association analysis of nine candidate gene polymorphisms in Indian patients with type 2 diabetic retinopathy.
21059648 2011 Pigment epithelium-derived factor and its phosphomimetic mutant induce JNK-dependent apoptosis and p38-mediated migration arrest.
21058962 2011 Increased serum levels of pigment epithelium-derived factor by excessive alcohol consumption-detection and identification by a three-step serum proteome analysis.
20857208 2011 Pigment epithelium-derived factor plays an inhibitory role in proliferation and migration of HaCaT cells.
20709803 2010 Pigment epithelium-derived factor is an intrinsic antifibrosis factor targeting hepatic stellate cells.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20685859 2010 Plasma level of pigment epithelium-derived factor is independently associated with the development of the metabolic syndrome in Chinese men: a 10-year prospective study.
20678803 2011 Complement factor H and high-temperature requirement A-1 genotypes and treatment response of age-related macular degeneration.
20664971 2010 The pigment epithelial-derived factor gene loaded in PLGA nanoparticles for therapy of colon carcinoma.
20631025 2010 Circulating pigment epithelium-derived factor levels are associated with insulin resistance and decrease after weight loss.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20504225 2010 Pigment epithelium-derived factor expression in colorectal cancer patients.
20412062 2010 Pigment epithelium-derived factor binds to cell-surface F(1)-ATP synthase.
20381502 2010 Pigment epithelium-derived factor inhibits advanced glycation end product-elicited mesangial cell damage by blocking NF-kappaB activation.
20237999 2010 Pigment epithelium-derived factor receptor (PEDF-R): a plasma membrane-linked phospholipase with PEDF binding affinity.
20229034 2010 Evaluation of protein pigment epithelium-derived factor (PEDF) and microvessel density (MVD) as prognostic indicators in breast cancer.
20228934 2009 Attainment of polarity promotes growth factor secretion by retinal pigment epithelial cells: relevance to age-related macular degeneration.
20141354 2010 Protein kinase C beta (PRKCB1) and pigment epithelium derived factor (PEDF) gene polymorphisms and diabetic retinopathy in a south Indian cohort.
20132989 2010 Phenotype and genotype characteristics of age-related macular degeneration in a Japanese population.
20104255 2010 Down regulation of the PEDF gene in human lens epithelium cells changed the expression of proteins vimentin and alphaB-crystallin.
20087951 2010 Pigment epithelium-derived factor as a new marker of metabolic syndrome in Caucasian population.
19948828 2010 Pigment epithelium-derived factor inhibits lysosomal degradation of Bcl-xL and apoptosis in HepG2 cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19661223 2010 Constitutive overexpression of pigment epithelium-derived factor inhibition of ocular melanoma growth and metastasis.
19637042 2009 Unfavorable prognostic value of human PEDF decreased in high-grade prostatic intraepithelial neoplasia: a differential proteomics approach.
19635565 2010 Positive association of circulating levels of advanced glycation end products (AGEs) with pigment epithelium-derived factor (PEDF) in a general population.
19608741 2009 Nuclear receptor co-repressor is required to maintain proliferation of normal intestinal epithelial cells in culture and down-modulates the expression of pigment epithelium-derived factor.
19583952 2009 Pigment epithelium-derived factor contributes to insulin resistance in obesity.
19513563 2009 The molecular impact of pigment epithelium-derived factor, PEDF, on lung cancer cells and the clinical significance.
19503741 2009 Coding variant Met72Thr in the PEDF gene and risk of neovascular age-related macular degeneration and polypoidal choroidal vasculopathy.
19342598 2009 Late outgrowth endothelial cells derived from Wharton jelly in human umbilical cord reduce neointimal formation after vascular injury: involvement of pigment epithelium-derived factor.
19298519 2010 The anti-angiogenic factor PEDF is present in the human heart and is regulated by anoxia in cardiac myocytes and fibroblasts.
19253105 2009 The reduction in pigment epithelium-derived factor is a sign of malignancy in ovarian cancer expressing low-level of vascular endothelial growth factor.
19247457 2009 Anti-inflammatory effect of pigment epithelium-derived factor in DBA/2J mice.
19224861 2009 Laminin receptor involvement in the anti-angiogenic activity of pigment epithelium-derived factor.
19223990 2009 Analysis of three pigment epithelium-derived factor gene polymorphisms in patients with exudative age-related macular degeneration.
19182495 2009 Different expression of vascular endothelial growth factor and pigment epithelium-derived factor between diabetic and non-diabetic epiretinal membranes.
19180572 2009 Characterization of PEDF: a multi-functional serpin family protein.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19091957 2009 Cytosolic phospholipase A2-{alpha} is an early apoptotic activator in PEDF-induced endothelial cell apoptosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18845835 2008 Inhibition of nuclear translocation of apoptosis-inducing factor is an essential mechanism of the neuroprotective activity of pigment epithelium-derived factor in a rat model of retinal degeneration.
18805795 2008 Pigment epithelium-derived factor binds to hyaluronan. Mapping of a hyaluronan binding site.
18792873 2008 Pigment epithelium-derived factor (PEDF) ameliorates advanced glycation end product (AGE)-induced hepatic insulin resistance in vitro by suppressing Rac-1 activation.
18787502 2009 Genetic contributions to the development of retinopathy of prematurity.
18787046 2008 Plasma pigment epithelium-derived factor is positively associated with obesity in Caucasian subjects, in particular with the visceral fat depot.
18715664 2008 Increased serum pigment epithelium derived factor levels in Type 2 diabetes patients.
18704312 2008 Small hairpin loop RNA targeting HIF-1alpha down-regulates VEGF and up-regulates PEDF in human retinal pigment epithelial cells under hypoxic condition.
18677713 2009 Serum levels of pigment epithelium-derived factor (PEDF) are positively associated with visceral adiposity in Japanese patients with type 2 diabetes.
18676622 2008 Regulation of pigment epithelium-derived factor production and release by retinal glial (Müller) cells under hypoxia.
18625531 2009 Serum level of pigment epithelium derived factor (PEDF) is an independent determinant of resting heart rate in Japanese subjects.
18523656 2008 Relationship between pigment epithelium-derived factor (PEDF) and renal function in patients with diabetic retinopathy.
18455830 2008 Increased serum pigment epithelium-derived factor levels in type 1 diabetic patients with diabetic retinopathy.
18312852 2008 Upregulation of PEDF expression by PARP inhibition contributes to the decrease in hyperglycemia-induced apoptosis in HUVECs.
18226801 2008 Pigment epithelium-derived factor gene Met72Thr polymorphism is associated with increased risk of wet age-related macular degeneration.
18191271 2008 Anti-angiogenic pigment epithelium-derived factor regulates hepatocyte triglyceride content through adipose triglyceride lipase (ATGL).
18180304 2008 The constitutively active orphan G-protein-coupled receptor GPR39 protects from cell death by increasing secretion of pigment epithelium-derived growth factor.
18084848 Aqueous humour levels of asymmetric dimethylarginine (ADMA) are correlated with pigment epithelium-derived factor (PEDF) in patients with uveitis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17870167 2008 Pigment epithelium-derived factor induces THP-1 macrophage apoptosis and necrosis by the induction of the peroxisome proliferator-activated receptor gamma.
17658465 2007 Promoter polymorphisms of the pigment epithelium-derived factor gene are associated with diabetic retinopathy.
17651710 2007 PEDF induces p53-mediated apoptosis through PPAR gamma signaling in human umbilical vein endothelial cells.
17604022 2007 Correlation between levels of pigment epithelium-derived factor and vascular endothelial growth factor in the striatum of patients with Parkinson's disease.
17593873 Hydrogen peroxide stimulates pigment epithelium-derived factor gene and protein expression in the human hepatocyte cell line OUMS-29.
17525281 2007 Pigment epithelium-derived factor inhibits neointimal hyperplasia after vascular injury by blocking NADPH oxidase-mediated reactive oxygen species generation.
17479108 2007 Pigment epithelium-derived factor overexpression inhibits orthotopic osteosarcoma growth, angiogenesis and metastasis.
17213275 2007 Plasma concentration of pigment epithelium-derived factor in patients with diabetic retinopathy.
17202143 2007 Heparin binding induces a conformational change in pigment epithelium-derived factor.
17188371 2007 Pigment epithelium-derived factor in ulcerative colitis: possible relationship with disease activity.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16896539 2006 Age- and cell cycle-dependent changes in EPC-1/PEDF promoter activity in human diploid fibroblast-like (HDF) cells.
16797605 Pigment epithelium-derived factor (PEDF) prevents diabetes- or advanced glycation end products (AGE)-elicited retinal leukostasis.
16777976 2006 Pigment epithelium-derived factor is estrogen sensitive and inhibits the growth of human ovarian cancer and ovarian surface epithelial cells.
16740777 2006 Decreased pigment epithelium-derived factor expression in human breast cancer progression.
16707486 2006 Pigment epithelium-derived factor inhibits advanced glycation end product-induced retinal vascular hyperpermeability by blocking reactive oxygen species-mediated vascular endothelial growth factor expression.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16596284 2006 Expression of pigment epithelial derived factor is reduced in non-small cell lung cancer and is linked to clinical outcome.
16409998 2006 Contribution of VEGF and PEDF to choroidal angiogenesis: a need for balanced expressions.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16322471 2006 Variable phosphorylation states of pigment-epithelium-derived factor differentially regulate its function.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16196102 2005 Pigment epithelium-derived factor is differentially expressed in peripheral neuropathies.
16102727 2005 Involvement of the collagen I-binding motif in the anti-angiogenic activity of pigment epithelium-derived factor.
15994443 2005 Cytoplasmic expression and extracellular deposition of an antiangiogenic factor, pigment epithelium-derived factor, in human atherosclerotic plaques.
15856012 2005 Identification of pigment epithelium-derived factor as a direct target of the p53 family member genes.
15846509 2005 Pigment epithelium-derived factor (PEDF) blocks angiotensin II signaling in endothelial cells via suppression of NADPH oxidase: a novel anti-oxidative mechanism of PEDF.
15713745 2005 Pigment epithelium-derived factor inhibits fibroblast-growth-factor-2-induced capillary morphogenesis of endothelial cells through Fyn.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15377265 2004 Different mechanisms of protective and differentiative activities of homological peptides TGENHR and TQVEHR.
15374885 2005 Extracellular phosphorylation converts pigment epithelium-derived factor from a neurotrophic to an antiangiogenic factor.
15239109 2004 Antiangiogenic property of pigment epithelium-derived factor in hepatocellular carcinoma.
15150108 2004 Expression of pigment epithelium-derived factor decreases liver metastasis and correlates with favorable prognosis for patients with ductal pancreatic adenocarcinoma.
15140209 2004 Loss of EPC-1/PEDF expression during skin aging in vivo.
15096582 2004 Identification of the antivasopermeability effect of pigment epithelium-derived factor and its active site.
14991838 2004 In vitro studies of pigment epithelium-derived factor in human Schwann cells after treatment with axolemma-enriched fraction.
12920663 2003 Proliferative diabetic retinopathy is associated with a low level of the natural ocular anti-angiogenic agent pigment epithelium-derived factor (PEDF) in aqueous humor. a pilot study.
12878936 2003 In vivo gene transfer of pigment epithelium-derived factor inhibits tumor growth in syngeneic murine models of thoracic malignancies.
12860293 2003 Regulation of the expression of pigment epithelium-derived factor, an anti-angiogenic factor in human oral squamous cell carcinoma cell lines.
12837042 2002 Pigment epithelium-derived factor Met72Thr polymorphism in patients with diabetic microangiopathy.
12827055 2003 Decreased pigment epithelium-derived factor and increased vascular endothelial growth factor levels in pterygia.
12740569 2003 Pigment epithelium-derived factor regulates the vasculature and mass of the prostate and pancreas.
12737624 2003 Pigment-epithelium-derived factor (PEDF) occurs at a physiologically relevant concentration in human blood: purification and characterization.
12711260 2003 Pigment epithelium-derived factor inhibits leptin-induced angiogenesis by suppressing vascular endothelial growth factor gene expression through anti-oxidative properties.
12687338 2003 Low content of the natural ocular anti-angiogenic agent pigment epithelium-derived factor (PEDF) in aqueous humor predicts progression of diabetic retinopathy.
12670505 2003 Vascular endothelial growth factor upregulates pigment epithelium-derived factor expression via VEGFR-1 in human retinal pigment epithelial cells.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12603315 2003 Secretion of pigment epithelium-derived factor. Mutagenic study.
12599204 2003 Putative role for EPC-1/PEDF in the G0 growth arrest of human diploid fibroblasts.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237317 2002 Mapping the type I collagen-binding site on pigment epithelium-derived factor. Implications for its antiangiogenic activity.
12208245 2002 Unbalanced vitreous levels of pigment epithelium-derived factor and vascular endothelial growth factor in diabetic retinopathy.
12200129 2002 Pigment epithelium-derived factor protects cultured retinal pericytes from advanced glycation end product-induced injury through its antioxidative properties.
11927940 2002 Inducer-stimulated Fas targets activated endothelium for destruction by anti-angiogenic thrombospondin-1 and pigment epithelium-derived factor.
11726635 2001 Evidence for pigment epithelium-derived factor receptors in the neural retina.
11562499 2001 Crystal structure of human PEDF, a potent anti-angiogenic and neurite growth-promoting factor.
11438800 2001 Localization of pigment epithelium derived factor (PEDF) in developing and adult human ocular tissues.
10655537 2000 Pigment-epithelium-derived factor--a key coordinator of retinal neuronal and vascular functions.
10531367 1999 Binding of pigment epithelium-derived factor (PEDF) to retinoblastoma cells and cerebellar granule neurons. Evidence for a PEDF receptor.
10398730 1999 Four polymorphic variations in the PEDF gene identified during the mutation screening of patients with Leber congenital amaurosis.
10398599 1999 Pigment epithelium-derived factor: a potent inhibitor of angiogenesis.
9692954 1998 Pigment epithelium-derived factor (PEDF) binds to glycosaminoglycans: analysis of the binding site.
9238088 1996 Organization, evolutionary conservation, expression and unusual Alu density of the human gene for pigment epithelium-derived factor, a unique neurotrophic serpin.
8977492 1996 Gene expression of the neurotrophic pigment epithelium-derived factor in the human ciliary epithelium. Synthesis and secretion into the aqueous humor.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8473338 1993 Senescent WI-38 cells fail to express EPC-1, a gene induced in young cells upon entry into the G0 state.
8434014 1993 Pigment epithelium-derived factor: neurotrophic activity and identification as a member of the serine protease inhibitor gene family.
8226833 1993 Overexpression of fetal human pigment epithelium-derived factor in Escherichia coli. A functionally active neurotrophic factor.
8188257 1994 Localization of the gene for pigment epithelium-derived factor (PEDF) to chromosome 17p13.1 and expression in cultured human retinoblastoma cells.
7592790 1995 Pigment epithelium-derived factor behaves like a noninhibitory serpin. Neurotrophic activity does not require the serpin reactive loop.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.