Property Summary

NCBI Gene PubMed Count 78
PubMed Score 382.27
PubTator Score 632.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 2.1e-02
ependymoma -1.200 3.9e-02
group 4 medulloblastoma -3.300 2.0e-09
cystic fibrosis 4.278 3.3e-08
atypical teratoid / rhabdoid tumor -2.800 7.1e-05
medulloblastoma, large-cell -3.900 1.3e-06
Duchenne muscular dystrophy 1.889 3.1e-07
primary pancreatic ductal adenocarcinoma 1.961 2.4e-02
non-small cell lung cancer 2.299 6.3e-16
intraductal papillary-mucinous adenoma (... -2.400 1.2e-02
colon cancer 1.400 2.7e-02
lung cancer 1.800 4.4e-05
interstitial cystitis 2.500 9.8e-05
lung adenocarcinoma 1.300 1.1e-06
primary Sjogren syndrome 1.400 7.4e-03
lung carcinoma 1.600 1.4e-10
gastric carcinoma 2.800 2.9e-03
pterygium 1.200 4.2e-03
ductal carcinoma in situ 1.600 4.3e-04
acute myeloid leukemia -3.800 5.1e-06
ulcerative colitis 1.700 1.9e-04
ovarian cancer -2.100 2.4e-02
pancreatic cancer 2.400 7.3e-03

Protein-protein Interaction (2)

Gene RIF (62)

PMID Text
26305372 together, these data demonstrate that SERPINE2 might prevent cartilage catabolism by inhibiting the expression of MMP-13, one of the most relevant collagenases, involved in cartilage breakdown in OA.
26214473 The results suggest that the rs3795879 polymorphism of SERPINE2 is not a risk factor for chronic obstructive pulmonary disease.
25901736 aberrant Serpine2/Pn-1 is required for proliferation of human and mouse medulloblastoma cells.
25517131 MAGI2, SERPINE2, and NT5C3B expression levels are associated with airway wall thickening and additionally with bronchial inflammation, emphysema, and lung function, respectively, all features of chronic obstructive pulmonary disease.
25359682 Our findings indicate that upregulated SERPINE2 may contribute to the aggressive phenotype of gastric cancer and suggest that SERPINE2 can be used as a novel prognostic factor and anticancer target in patients with gastric cancer.
25199049 role in lung homeostasis and pulmonary fibrosis
24587150 Haplotypes carrying major alleles of rs729631 (C), rs975278 (G), rs7583463 (C) of SERPINE2 had protective effect on lung function amongst South Indian male smokers with COPD.
24023701 SERPINE2 and PLAU are involved in cumulus expansion and oocyte maturation.
23661674 Endothelial protease nexin-1 is a novel regulator of A disintegrin and metalloproteinase 17 maturation and endothelial protein C receptor shedding via furin inhibition.
23385179 Studies suggest that protease nexin 1 as a marker of prostate cancer.
23041623 PN1 regulates Hh signaling by decreasing protein levels of the Hh ligand Sonic (SHH) and its downstream effectors.
22618708 crystal structures of PN1 in complex with heparin and catalytically inert thrombin suggest a unique 2-step mechanism of thrombin recognition involving rapid electrostatics-driven association
22331468 PN-1 has direct antiangiogenic properties and is a yet-unrecognized player in the angiogenic balance
22145704 The variant allele of the rs729631 SNP was found to pose over two-fold risk for overall panlobular changes and over four-fold risk for pathological panlobular changes.
22028159 Data suggested that there was no significant association between SERPINE2 polymorphism and COPD susceptibility in the Chinese Han population.
21806836 data identify the temporal and spatial SERPINE2 distribution in the human placenta and suggest its possible role in modulating tissue remodeling of extravillous trophoblasts in the placenta during pregnancy.
21611750 SERPINE2 gene is a chronic obstructive pulmonary disease susceptibility gene, and block 1 of SERPINE2 appears to be the genetic variant region that affects the Han Chinese.
21436250 Results weakly support SERPINE2 as a Dutch hypothesis candidate gene through nominally significant associations with asthma and related traits.
21426587 SERPINE2 protein is highly expressed in the endometrium during the secretory phase, indicating that it may participate in tissue remodeling involved in implantation.
21403095 platelet PN-1 can be considered as a new important regulator of thrombolysis in vivo
21067581 SERPINE2 may be a risk factor for the development of emphysema and its association with emphysema may be stronger in smokers.
21067581 Observational study of gene-disease association. (HuGE Navigator)
20942929 data indicate that serpinE2 is up-regulated by oncogenic activation of Ras, BRAF and MEK1 and contributes to pro-neoplastic actions of ERK signaling in intestinal epithelial cells.
20819545 In cerebellum, thrombin can activate PAR-1 expression after ICH, and PN-1 appears quickly after Intracerebral hemorrhage in order to control the deleterious effect of thrombin.
20805453 SERPINE2 was overexpressed in the ER-negative breast cancer group.
20623540 human astrocytes express Pn-1 and astrocytic expression is regulated in a dynamic manner by injury-related factors
20525719 Observational study of gene-disease association. (HuGE Navigator)
20463177 SERPINE2, was previously identified as a COPD susceptibility gene in the chromosome 2q linkage region. Using independent genotyping data in 2 smaller studies in Boston and Norway the results were replicated.
20298363 Observational study of gene-disease association. (HuGE Navigator)
20233420 Observational study of gene-disease association. (HuGE Navigator)
20035713 SERPINE2 was identified as a possible promoter of testicular germ cell tumors lymph node metastasis.
19949669 Results suggest that the SERPINE2 gene contributes to the susceptibility to COPD.
19949669 Observational study of gene-disease association. (HuGE Navigator)
19855083 Platelet PN-1 is a key player in the thrombotic process, whose negative regulatory role has been, up to now, markedly underestimated.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19626039 our results seem to discard the role of the previously described polymorphisms in SERPINE2, PPP6C and PBX3 in celiac disease susceptibility.
19626039 Observational study of gene-disease association. (HuGE Navigator)
19604412 Our results failed to obtain the evidence that these SNPs in SERPINE2 contributed to the chronic obstructive pulmonary disease susceptibility in the Han Chinese population
19604412 Observational study of gene-disease association. (HuGE Navigator)
19584287 Results suggest that PN-1 might become a prognostic marker in breast cancer.
19439404 High affinity binding of non-proteinase-complexed PAI-1 and PN-1 occurred to all LRP1 fragments containing three CR domains (3-59 nm) and most that contain only two CR domains
19249338 Here, we report that nexin-1 inhibits trypsin-4, and forms stable complexes only with this trypsin-isoenzyme. This result suggests that nexin-1 could modulate trypsin activity in brain where both nexin-1 and trypsin-4 are expressed.
19111454 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19017876 in severe COPD, SNPs in EPHX1 and SERPINE2 were associated with hypoxemia
19017876 Observational study of gene-disease association. (HuGE Navigator)
18617644 Macrophages and platelets are the major source of protease nexin-1 in human atherosclerotic plaque.
18550614 Observational study of gene-disease association. (HuGE Navigator)
17934860 Observational study of gene-disease association. (HuGE Navigator)
17703087 Co-injection of pancreatic stellate cells and tumor cells dramatically enhances the invasive potential of SERPINE2-expressing SUIT-2 cells in nude mice.
17690329 Observational study of gene-disease association. (HuGE Navigator)
17446335 Observational study of gene-disease association. (HuGE Navigator)
17446335 provides support for SERPINE2 as a COPD susceptibility gene
17379830 Protease nexin-1 forms complexes with thrombomodulin and modulates its anticoagulant activity.
16921128 Expression array analysis demonstrated association and repication of SERPINE2 as a potential COPD susceptibility gene.
16741952 This study shows that syndecan-1-mediated internalization of protease nexin-1 stimulated the Ras-ERK signaling pathway.
16358219 Observational study of gene-disease association. (HuGE Navigator)
16358219 SERPINE2 is a COPD-susceptibility gene and is likely influenced by gene-by-smoking interaction.
16085935 Arg15, Phe34, Pro13, and Arg20 are important for FXIa inhibition by PN2 Kunitz protease inhibitor domain
16015279 The pericyte expression of protease nexin 1 may provide endogenous anticoagulant activity.
12859287 the 4G/4G-PAI-1 genotype might be a protective factor against atherothrombotic cerebral infarction (ACI), whereas the factor V point mutation (1691G-A) and the factor VII Arg/Gln353 gene polymorphism have not proved to be risk factors for ACI
12356769 PN1 may play a much larger role in the modeling and remodeling of brain tissues during development and is not simply an extravasated thrombin clearance mechanism as previously suggested
11925594 Elevated levels of GDN/PN1 and XIP mRNAs induced by Allitridi provide valuable molecular evidence for elucidating garlic's efficacies against neurodegenerative and inflammatory diseases.

AA Sequence

MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGAD      1 - 70
GRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRN     71 - 140
VNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAA    141 - 210
DGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSW    211 - 280
MSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSED    281 - 350
GTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP                          351 - 398
//

Text Mined References (81)

PMID Year Title
26305372 2015 SERPINE2 Inhibits IL-1?-Induced MMP-13 Expression in Human Chondrocytes: Involvement of ERK/NF-?B/AP-1 Pathways.
26214473 2015 Association between the rs3795879 G/A polymorphism of the SERPINE2 gene and chronic obstructive pulmonary disease: a meta-analysis.
25901736 2015 Serpine2/PN-1 Is Required for Proliferative Expansion of Pre-Neoplastic Lesions and Malignant Progression to Medulloblastoma.
25517131 2015 Novel genes for airway wall thickness identified with combined genome-wide association and expression analyses.
25416956 2014 A proteome-scale map of the human interactome network.
25359682 2015 Prognostic significance of SERPINE2 in gastric cancer and its biological function in SGC7901 cells.
25199049 2014 Increased expression of protease nexin-1 in fibroblasts during idiopathic pulmonary fibrosis regulates thrombin activity and fibronectin expression.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24587150 2014 Genetic determinants of chronic obstructive pulmonary disease in South Indian male smokers.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24023701 2013 Involvement of the serine protease inhibitor, SERPINE2, and the urokinase plasminogen activator in cumulus expansion and oocyte maturation.
23661674 2013 Endothelial protease nexin-1 is a novel regulator of A disintegrin and metalloproteinase 17 maturation and endothelial protein C receptor shedding via furin inhibition.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23385179 2013 Protease nexin 1: a novel regulator of prostate cancer cell growth and neo-angiogenesis.
23041623 2012 Protease nexin 1 inhibits hedgehog signaling in prostate adenocarcinoma.
22618708 2012 Crystal structures of protease nexin-1 in complex with heparin and thrombin suggest a 2-step recognition mechanism.
22331468 2012 In vitro and in vivo antiangiogenic properties of the serpin protease nexin-1.
22145704 2011 SERPINE2 haplotype as a risk factor for panlobular type of emphysema.
22028159 2011 The association of SERPINE2 gene with COPD in a Chinese Han population.
21806836 2011 Spatiotemporal expression of SERPINE2 in the human placenta and its role in extravillous trophoblast migration and invasion.
21611750 2012 Association of SERPINE2 gene with the risk of chronic obstructive pulmonary disease and spirometric phenotypes in northern Han Chinese population.
21436250 2011 Association of SERPINE2 with asthma.
21426587 2011 SERPINE2, an inhibitor of plasminogen activators, is highly expressed in the human endometrium during the secretory phase.
21403095 2011 Platelet protease nexin-1, a serpin that strongly influences fibrinolysis and thrombolysis.
21067581 2010 Polymorphism of SERPINE2 gene is associated with pulmonary emphysema in consecutive autopsy cases.
20942929 2010 The serine protease inhibitor serpinE2 is a novel target of ERK signaling involved in human colorectal tumorigenesis.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20819545 2010 Expression of thrombin and its associated protein in cerebellum of human and rat after intracerebral hemorrhage.
20805453 2010 Molecular anatomy of breast cancer stroma and its prognostic value in estrogen receptor-positive and -negative cancers.
20623540 2010 Expression of plasminogen activator inhibitor-1 and protease nexin-1 in human astrocytes: Response to injury-related factors.
20525719 2011 Association of COPD candidate genes with computed tomography emphysema and airway phenotypes in severe COPD.
20463177 2010 Multistudy fine mapping of chromosome 2q identifies XRCC5 as a chronic obstructive pulmonary disease susceptibility gene.
20298363 2008 Genetics of chronic obstructive pulmonary disease: a case-control study in Bergen, Norway.
20233420 2010 Cluster analysis in severe emphysema subjects using phenotype and genotype data: an exploratory investigation.
20035713 2010 SERPINE2 is a possible candidate promotor for lymph node metastasis in testicular cancer.
19949669 2009 SERPINE2 polymorphisms and chronic obstructive pulmonary disease.
19911255 2010 Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor.
19855083 2010 Anticoagulant and antithrombotic properties of platelet protease nexin-1.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19626039 2009 Lack of replication of celiac disease risk variants reported in a Spanish population using an independent Spanish sample.
19604412 2009 Absence of association between SERPINE2 genetic polymorphisms and chronic obstructive pulmonary disease in Han Chinese: a case-control cohort study.
19584287 2009 The serine protease inhibitor protease nexin-1 controls mammary cancer metastasis through LRP-1-mediated MMP-9 expression.
19439404 2009 Specificity of binding of the low density lipoprotein receptor-related protein to different conformational states of the clade E serpins plasminogen activator inhibitor-1 and proteinase nexin-1.
19249338 2009 Nexin-1 inhibits the activity of human brain trypsin.
19111454 2009 Genetic association analysis of COPD candidate genes with bronchodilator responsiveness.
19017876 2009 Genetic associations with hypoxemia and pulmonary arterial pressure in COPD.
18617644 2008 Macrophages and platelets are the major source of protease nexin-1 in human atherosclerotic plaque.
18550614 2008 Polymorphic variation in surfactant protein B is associated with COPD exacerbations.
17934860 2008 Mcp-1, eNOS, tPA and PAI-1 gene polymorphism and correlation of genotypes and phenotypes in hepatopulmonary syndrome.
17703087 2007 Pancreatic stellate cells potentiate proinvasive effects of SERPINE2 expression in pancreatic cancer xenograft tumors.
17690329 2008 IL10 polymorphisms are associated with airflow obstruction in severe alpha1-antitrypsin deficiency.
17446335 2007 The SERPINE2 gene is associated with chronic obstructive pulmonary disease in two large populations.
17379830 2007 Protease nexin-1 interacts with thrombomodulin and modulates its anticoagulant effect.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16921128 2006 The SERPINE2 gene is associated with chronic obstructive pulmonary disease.
16741952 2006 Activation of ERK signaling upon alternative protease nexin-1 internalization mediated by syndecan-1.
16358219 2006 The SERPINE2 gene is associated with chronic obstructive pulmonary disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16085935 2005 Structural and mutational analyses of the molecular interactions between the catalytic domain of factor XIa and the Kunitz protease inhibitor domain of protease nexin 2.
16015279 2006 Brain endothelial hemostasis regulation by pericytes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12859287 2003 Prothrombotic gene polymorphisms and atherothrombotic cerebral infarction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356769 2002 Protease nexin 1 is a potent urinary plasminogen activator inhibitor in the presence of collagen type IV.
12106474 1991 Modulation of Human Neurite Outgrowth by Serine Proteases: A Comparison of the Interaction of Thrombin and Prothrombin with Glia-Derived Nexin.
11925594 2002 Applying a highly specific and reproducible cDNA RDA method to clone garlic up-regulated genes in human gastric cancer cells.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8006028 1994 Regulation of protease nexin-1 target protease specificity by collagen type IV.
7665170 1995 The gene for the serpin thrombin inhibitor (PI7), protease nexin I, is located on human chromosome 2q33-q35 and on syntenic regions in the mouse and sheep genomes.
3997857 1985 Protease nexin. Properties and a modified purification procedure.
3427015 1987 cDNA sequence coding for a rat glia-derived nexin and its homology to members of the serpin superfamily.
3279057 1988 Localization of protease nexin-1 on the fibroblast extracellular matrix.
2877744 1986 A glia-derived neurite promoting factor with protease inhibitory activity belongs to the protease nexins.
2037625 1991 Plasminogen activators and inhibitors in the neuromuscular system: III. The serpin protease nexin I is synthesized by muscle and localized at neuromuscular synapses.
1939253 1991 Protease specificity and heparin binding and activation of recombinant protease nexin I.
1691280 1990 Reciprocal modulation of astrocyte stellation by thrombin and protease nexin-1.
1334458 1992 Extracellular proteolytic cleavage by urokinase is required for activation of hepatocyte growth factor/scatter factor.