Property Summary

NCBI Gene PubMed Count 52
PubMed Score 739.23
PubTator Score 387.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial lung disease 2.800 3.2e-02
malignant mesothelioma -2.100 1.2e-07
pancreatic ductal adenocarcinoma liver m... -3.315 2.0e-02
lung cancer 1.700 3.1e-03
sarcoidosis -1.300 2.7e-02
psoriasis 1.100 1.6e-08

Protein-protein Interaction (2)

Gene RIF (21)

PMID Text
25130770 heparin co-factor II is a novel metastasis enhancer and may be used as a prognostic predictor for heparin treatment in non-small cell lung cancer
23656734 In this study, we demonstrate a previously unknown role for HCII in host defense.
23496873 Molecular modelling of HCII 1-75 predicted those portions of the acidic extension that had been previously visualized in crystal structures, and suggested that an alpha-helix found between residues 26 and 36 stabilizes one found between residues 61-67.
22904320 HCII potentiates the activation of vascular endothelial cells and the promotion of angiogenesis in response to hindlimb ischemia via an AMPK-eNOS signaling pathway.
21107326 Plasma heparin cofactor II activity was independently and inversely associated with the development of cardiac remodeling, including cardiac concentric change, left atrial enlargement and left ventricular diastolic dysfunction.
20671370 [REVIEW]HCII protects against vascular remodeling, including atherosclerosis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20053992 potential for oversulfated disaccharides in controlling HCII-regulated thrombin generation
19913121 Observational study of gene-disease association. (HuGE Navigator)
19747479 These results suggest that HCII is in a position to inhibit thrombin in atherosclerotic lesions where thrombin can exert a proatherogenic inflammatory response.
18971786 Plasma heparin cofactor II activity is an independent predictor of future cardiovascular events in patients after acute myocardial infarction.
18383370 Beta2-glycoprotein I (B2G1) protected thrombin against inactivation by HCII (heparin cofactor II)/heparin
16981704 These results suggest that transfer of the N-terminal acidic extension of HCII to alpha1-PI M358R enhanced its inhibition of thrombin by conferring the ability to bind exosite 1 on HAPI M358R.
16339402 HCII activity increases during pregnancy, and HCII levels are significantly decreased in women with severe pre-eclampsia.
15543340 after receiving stent for peripheral artery disease, patients with a high HCII activity had a 0.39-fold reduced risk for instent restenosis
15337701 An asymptomatic Glu428Lys mutation affecting a conserved glutamate at the hinge (P17) of the reactive loop confirms the key structural role of the P17 glutamate in serpins.
15292227 structure analysis of the thrombin-heparin cofactor II complex
15247982 The interactions of HCII with various heparins in solution competition experiments using SPR show that while calcium enhances this interaction, the activity of heparin-HCII complex against thrombin is not calcium dependent but can be enhanced by it.
12152684 Altering heparin cofactor II at VAL439 (P6) either impairs inhibition of thrombin or confers elastase resistance.
12095635 role of basic amino acids of the A helix of heparin cofactor II in heparin- or dermatan sulfate-mediated thrombin inhibition.
11856753 Aspartic acid residues 72 and 75 and tyrosine-sulfate 73 of heparin cofactor II promote

AA Sequence

MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFHKENTVTNDWI      1 - 70
PEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHGKSRIQRLNILNAKFAFNLYRV     71 - 140
LKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLF    141 - 210
RRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALEN    211 - 280
IDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYV    281 - 350
GGISMLIVVPHKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDK    351 - 420
NGNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRFTVDRPFLFLIYEHRTSCLLFM    421 - 490
GRVANPSRS                                                                 491 - 499
//

Text Mined References (57)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25130770 2015 Heparin co-factor II enhances cell motility and promotes metastasis in non-small cell lung cancer.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23656734 2013 Proteolytic activation transforms heparin cofactor II into a host defense molecule.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23496873 2013 The complete N-terminal extension of heparin cofactor II is required for maximal effectiveness as a thrombin exosite 1 ligand.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22904320 2012 Heparin cofactor II, a serine protease inhibitor, promotes angiogenesis via activation of the AMP-activated protein kinase-endothelial nitric-oxide synthase signaling pathway.
21107326 2011 Plasma heparin cofactor II activity is inversely associated with left atrial volume and diastolic dysfunction in humans with cardiovascular risk factors.
20671370 2010 Heparin cofactor II attenuates vascular remodeling in humans and mice.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20053992 2010 Sucrose octasulfate selectively accelerates thrombin inactivation by heparin cofactor II.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19747479 2009 Heparin cofactor II in atherosclerotic lesions from the Pathobiological Determinants of Atherosclerosis in Youth (PDAY) study.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18971786 2008 Plasma heparin cofactor II activity is an independent predictor of future cardiovascular events in patients after acute myocardial infarction.
18383370 2008 Beta2-glycoprotein I protects thrombin from inhibition by heparin cofactor II: potentiation of this effect in the presence of anti-beta2-glycoprotein I autoantibodies.
16981704 2006 The transferable tail: fusion of the N-terminal acidic extension of heparin cofactor II to alpha1-proteinase inhibitor M358R specifically increases the rate of thrombin inhibition.
16339402 2006 Placental dermatan sulfate: isolation, anticoagulant activity, and association with heparin cofactor II.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15543340 2004 High plasma heparin cofactor II activity protects from restenosis after femoropopliteal stenting.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15337701 2004 Homozygous deficiency of heparin cofactor II: relevance of P17 glutamate residue in serpins, relationship with conformational diseases, and role in thrombosis.
15292227 2004 Molecular mapping of the thrombin-heparin cofactor II complex.
15247982 2004 Studies on the effect of calcium in interactions between heparin and heparin cofactor II using surface plasmon resonance.
15148272 2004 Heparin cofactor II is a novel protective factor against carotid atherosclerosis in elderly individuals.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12361205 2002 Plasma levels of heparin cofactor II (HCII) and thrombin-HCII complex in patients with disseminated intravascular coagulation.
12169660 2002 Crystal structures of native and thrombin-complexed heparin cofactor II reveal a multistep allosteric mechanism.
12152684 2002 Altering heparin cofactor II at VAL439 (P6) either impairs inhibition of thrombin or confers elastase resistance.
11846800 2002 Tyrosine sulfation and N-glycosylation of human heparin cofactor II from plasma and recombinant Chinese hamster ovary cells and their effects on heparin binding.
11323006 2001 Heparin cofactor II, antithrombin-beta and their complexes with thrombin in human tissues.
11204559 2001 Molecular mechanism of type I congenital heparin cofactor (HC) II deficiency caused by a missense mutation at reactive P2 site: HC II Tokushima.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
8562924 1996 Molecular and cellular basis for type I heparin cofactor II deficiency (heparin cofactor II Awaji).
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7545318 1995 Inhibition of thrombin by antithrombin III and heparin cofactor II in vivo.
3907702 1985 Structural evidence for leucine at the reactive site of heparin cofactor II.
3782093 1986 Identification of two sites of sulfation of human heparin cofactor II.
3755044 1986 Isolation and characterization of a partial cDNA clone for heparin cofactor II1.
3379101 1988 Effects of fibroblasts and endothelial cells on inactivation of target proteases by protease nexin-1, heparin cofactor II, and C1-inhibitor.
3003690 1986 A new member of the plasma protease inhibitor gene family.
2894851 1988 Heparin cofactor II: cDNA sequence, chromosome localization, restriction fragment length polymorphism, and expression in Escherichia coli.
2841345 1988 Structure and expression of the gene coding for the human serpin hLS2.
2760054 1989 Antithrombin activity of a peptide corresponding to residues 54-75 of heparin cofactor II.
2647747 1989 Heparin cofactor IIOslo. Mutation of Arg-189 to His decreases the affinity for dermatan sulfate.
2552799 1989 Serpin receptor 1: a hepatic receptor that mediates the clearance of antithrombin III-proteinase complexes.
2318847 1990 Interaction of heparin cofactor II with neutrophil elastase and cathepsin G.
2104620 1990 Site-directed mutagenesis of arginine 103 and lysine 185 in the proposed glycosaminoglycan-binding site of heparin cofactor II.
1985958 1991 Leukocyte chemoattractant peptides from the serpin heparin cofactor II.
1939083 1991 The N-terminal acidic domain of heparin cofactor II mediates the inhibition of alpha-thrombin in the presence of glycosaminoglycans.
1836773 1991 Tissue anticoagulants in the human placenta: preliminary study with a heparin-like anticoagulant and review of the literature.
1671335 1991 Complete nucleotide sequence of the gene for human heparin cofactor II and mapping to chromosomal band 22q11.