Property Summary

NCBI Gene PubMed Count 21
PubMed Score 220.75
PubTator Score 18.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis 1.400 1.0e-07
malignant mesothelioma -1.800 2.3e-07
osteosarcoma 2.168 3.4e-07
cystic fibrosis 1.391 7.3e-06
non diabetic and post-ischemic heart fai... -1.100 7.4e-03
atypical teratoid / rhabdoid tumor 1.200 7.3e-03
glioblastoma 1.200 2.7e-04
medulloblastoma, large-cell 1.600 2.3e-05
tuberculosis and treatment for 3 months -2.000 2.4e-05
lung cancer -1.500 5.5e-04
ulcerative colitis 1.400 7.4e-04
adult high grade glioma 1.200 4.8e-03
pilocytic astrocytoma 1.100 4.4e-07
lung carcinoma -1.800 8.5e-22
ovarian cancer 2.300 2.0e-12

Gene RIF (6)

PMID Text
20953187 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19188865 Data show that SERPINB8 is expressed in normal neuroendocrine cells of several organs as well as in neuroendocrine tumors of the pancreas, where it can be used as an additional diagnostic immunohistochemical marker.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16493485 PI8 is released by platelets and controls functional responses

AA Sequence

MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGF      1 - 70
QSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKT     71 - 140
EGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADE    141 - 210
VHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLE    211 - 280
PFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCAD    281 - 350
HPFLFFIRHHKTNCILFCGRFSSP                                                  351 - 374
//

Text Mined References (26)

PMID Year Title
27476651 2016 Loss-of-Function Mutations in SERPINB8 Linked to Exfoliative Ichthyosis with Impaired Mechanical Stability of Intercellular Adhesions.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21269460 2011 Initial characterization of the human central proteome.
20953187 2010 Association analyses identify six new psoriasis susceptibility loci in the Chinese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19188865 2009 Serine protease inhibitor 8 is a novel immunohistochemical marker for neuroendocrine tumors of the pancreas.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16493485 2006 The serpin proteinase inhibitor 8: an endogenous furin inhibitor released from human platelets.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417609 2002 Distribution of the human intracellular serpin protease inhibitor 8 in human tissues.
9442015 1998 Inhibition of soluble recombinant furin by human proteinase inhibitor 8.
9417904 1997 Mapping and characterization of novel (CAG)n repeat cDNAs from adult human brain derived by the oligo capture method.
9402754 1997 Expression, purification, and inhibitory properties of human proteinase inhibitor.
9268635 1997 Cytoplasmic antiproteinase 2 (PI8) and bomapin (PI10) map to the serpin cluster at 18q21.3.
8761950 1996 Mammalian CAP interacts with CAP, CAP2, and actin.
8530382 1995 Molecular cloning, expression, and partial characterization of two novel members of the ovalbumin family of serine proteinase inhibitors.
2690952 1989 Implications of the three-dimensional structure of alpha 1-antitrypsin for structure and function of serpins.