Property Summary

NCBI Gene PubMed Count 27
PubMed Score 835.74
PubTator Score 48.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.600 9.5e-04
posterior fossa group B ependymoma 1.200 2.7e-08
astrocytoma 1.300 9.8e-03
medulloblastoma, large-cell -1.900 2.4e-03
pancreatic ductal adenocarcinoma liver m... 1.299 2.8e-02
non-small cell lung cancer -1.102 1.2e-15
pilocytic astrocytoma 1.500 7.3e-09
subependymal giant cell astrocytoma 1.066 1.9e-02
nasopharyngeal carcinoma -1.400 4.4e-04
ovarian cancer -2.000 3.2e-05

Gene RIF (6)

PMID Text
20451170 A truncating mutation in SERPINB6 is associated with autosomal-recessive nonsyndromic sensorineural hearing loss.
19425502 the discovery overexpression of GPD1 and RRBP1 proteins and lack of expression for HNRNPH1 and SERPINB6 proteins which are new candidate biomarkers of colon cancer.
18976975 Knockdown of serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17761692 Protects the intracellular compartment of keratinocytes from ectopic kallikrein-8.
16175637 Expressed in developing gonads and in both somatic and germ cells of adult gonads.
14670919 In mast cells, SERPINB6 serves to regulate the activity of endogenous beta-tryptase in the cytoplasm.

AA Sequence

MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQ      1 - 70
GFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAE     71 - 140
KTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTY    141 - 210
IGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESY    211 - 280
DMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFC    281 - 350
ADHPFLFFIQHSKTNGILFCGRFSSP                                                351 - 376
//

Text Mined References (35)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20451170 2010 A truncating mutation in SERPINB6 is associated with autosomal-recessive nonsyndromic sensorineural hearing loss.
19425502 [Colorectal cancer 2D-proteomics: identification of altered protein expression].
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17761692 2007 SerpinB6 is an inhibitor of kallikrein-8 in keratinocytes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16175637 2006 Expression of serpinb6 serpins in germ and somatic cells of mouse gonads.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670919 2004 Intracellular serpin SERPINB6 (PI6) is abundantly expressed by human mast cells and forms complexes with beta-tryptase monomers.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
11745444 2001 Human kallikrein 2 (hK2), but not prostate-specific antigen (PSA), rapidly complexes with protease inhibitor 6 (PI-6) released from prostate carcinoma cells.
10463585 1999 Identification of a novel complex between human kallikrein 2 and protease inhibitor-6 in prostate cancer tissue.
10068683 1999 The intracellular serpin proteinase inhibitor 6 is expressed in monocytes and granulocytes and is a potent inhibitor of the azurophilic granule protease, cathepsin G.
9858835 1998 A serpin gene cluster on human chromosome 6p25 contains PI6, PI9 and ELANH2 which have a common structure almost identical to the 18q21 ovalbumin serpin genes.
9851866 1998 Proteinase inhibitor 6 (PI-6) expression in human skin: induction of PI-6 and a PI-6/proteinase complex during keratinocyte differentiation.
8662739 1996 Human cytoplasmic antiproteinase neutralizes rapidly and efficiently chymotrypsin and trypsin-like proteases utilizing distinct reactive site residues.
8636153 1996 Identification and characterization of the cytoplasmic antiproteinase (CAP) in human platelets. Evidence for the interaction of CAP with endogenous platelet proteins.
8486644 1993 Identification and purification of a novel serine proteinase inhibitor.
8415716 1993 Cloning and molecular characterization of a human intracellular serine proteinase inhibitor.
8408007 1993 Isolation and characterization of an intracellular serine proteinase inhibitor from a monkey kidney epithelial cell line.
8136380 1994 Complementary DNA cloning and kinetic characterization of a novel intracellular serine proteinase inhibitor: mechanism of action with trypsin and factor Xa as model proteinases.
7601482 1995 Chromosomal mapping of the human proteinase inhibitor 6 (PI6) gene to 6p25 by fluorescence in situ hybridization.
7548163 1995 Production and characterization of recombinant human proteinase inhibitor 6 expressed in Pichia pastoris.