Property Summary

NCBI Gene PubMed Count 19
PubMed Score 31.53
PubTator Score 19.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -4.200 2.3e-02
psoriasis 3.800 6.5e-13
cutaneous lupus erythematosus 2.100 2.2e-03
osteosarcoma -1.092 3.7e-04
Atopic dermatitis 1.900 7.3e-04
non-small cell lung cancer 3.505 2.7e-10
interstitial cystitis 2.000 3.0e-02
nasopharyngeal carcinoma -2.900 2.6e-04
spina bifida -2.855 3.7e-02
cystic fibrosis and chronic rhinosinusit... 1.633 3.6e-02

Gene RIF (9)

PMID Text
22593614 clade B serpins help to maintain homeostasis by inducing protective humoral immunity
21723253 These data demonstrate that RUNX1 is an important regulator of SERPINB13 and cathepsin K activity.
19690890 Observational study of gene-disease association. (HuGE Navigator)
19569240 Downregulation of SERPINB13 protein expression in HNSCC is positively associated with poor clinical outcome. Therefore, SERPINB13 seems to act as an important protease inhibitor involved in the progression of HNSCC.
16433682 the expression of hurpin was confined mainly to the basal layer in normal skin samples, whereas hurpin was overexpressed and redistributed in diseased skin
16357159 Down-regulation of SERPINB13 is associated with head and neck squamous cell carcinoma
15885077 hurpin is expressed in skin and has a possible role in inflammatory processes or the regulation of endogenous or pathogen-derived proteinase activity
12809493 Hurpin is a selective inhibitor of lysosomal cathepsin L and protects keratinocytes from ultraviolet-induced apoptosis.
12504904 A novel member of the serine proteinase inhibitor (Serpin) gene family that was originally cloned from a keratinocyte cDNA library. It has specificity for inhibiting lysosomal cysteine proteinases.

AA Sequence

MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKA      1 - 70
EEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA     71 - 140
ADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKS    141 - 210
VQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERK    211 - 280
VNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG    281 - 350
IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP                                 351 - 391
//

Text Mined References (21)

PMID Year Title
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22593614 2012 Enhanced anti-serpin antibody activity inhibits autoimmune inflammation in type 1 diabetes.
21723253 2011 SERPINB13 is a novel RUNX1 target gene.
21269460 2011 Initial characterization of the human central proteome.
19690890 2009 Genetic analysis of diabetic nephropathy on chromosome 18 in African Americans: linkage analysis and dense SNP mapping.
19569240 2009 Downregulation of SERPINB13 expression in head and neck squamous cell carcinomas associates with poor clinical outcome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16433682 2006 Expression of cathepsin L and its inhibitor hurpin in inflammatory and neoplastic skin diseases.
16357159 2005 Headpin: a serpin with endogenous and exogenous suppression of angiogenesis.
15885077 2005 Expression of hurpin, a serine proteinase inhibitor, in normal and pathological skin: overexpression and redistribution in psoriasis and cutaneous carcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12809493 2003 Hurpin is a selective inhibitor of lysosomal cathepsin L and protects keratinocytes from ultraviolet-induced apoptosis.
12504904 2003 Inhibition of the cysteine proteinases cathepsins K and L by the serpin headpin (SERPINB13): a kinetic analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11313015 2001 Sequence, organization, chromosomal localization, and alternative splicing of the human serine protease inhibitor gene hurpin (PI13) which is upregulated in psoriasis.
11004515 2000 Genomic cloning, mapping, structure and promoter analysis of HEADPIN, a serpin which is down-regulated in head and neck cancer cells.
10527881 1999 Identification and cDNA cloning of headpin, a novel differentially expressed serpin that maps to chromosome 18q.
10512713 1999 Cloning and characterization of hurpin (protease inhibitor 13): A new skin-specific, UV-repressible serine proteinase inhibitor of the ovalbumin serpin family.
9297979 1997 Analysis of UVB-modulated gene expression in human keratinocytes by mRNA differential display polymerase chain reaction.