Property Summary

NCBI Gene PubMed Count 12
PubMed Score 100.56
PubTator Score 26.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 472 0.0 0.0
Disease Target Count P-value
osteosarcoma 7766 2.6e-08
acute myeloid leukemia 760 3.2e-02

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -2.800 3.2e-02
osteosarcoma -3.765 2.6e-08

 GO Process (1)

Gene RIF (3)

AA Sequence

MDSLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQFNRDQGVKCDP      1 - 70
ESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQP     71 - 140
VNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRIN    141 - 210
ETTSKPVQMMFMKKKLHIFHIEKPKAVGLQLYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSAD    211 - 280
MMELYEVQLHLPKFKLEDSYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTE    281 - 350
AAAGSGSEIDIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP                           351 - 397
//

Text Mined References (12)

PMID Year Title