Property Summary

NCBI Gene PubMed Count 50
PubMed Score 336.30
PubTator Score 89.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.651 2.2e-06
astrocytic glioma -1.100 4.1e-02
Astrocytoma, Pilocytic 1.400 5.3e-05
Atopic dermatitis 1.200 1.7e-03
colon cancer 1.300 3.9e-02
cutaneous lupus erythematosus 1.200 1.5e-02
diabetes mellitus -1.400 9.9e-03
ependymoma 1.200 1.4e-04
glioblastoma 1.100 1.3e-02
juvenile dermatomyositis 1.047 9.2e-11
lung cancer -2.300 7.0e-05
lung carcinoma -1.600 1.2e-17
medulloblastoma, large-cell -1.400 1.0e-03
Multiple myeloma 1.284 2.4e-03
nasopharyngeal carcinoma -1.400 1.5e-03
non-small cell lung cancer -1.004 2.6e-06
osteosarcoma -2.164 3.5e-04
ovarian cancer -1.200 9.3e-03
psoriasis 1.500 3.7e-06
spina bifida -1.060 3.6e-02
subependymal giant cell astrocytoma 1.735 1.5e-02
Waldenstrons macroglobulinemia 2.021 2.5e-02

 GO Process (1)

Gene RIF (17)

AA Sequence

MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRF      1 - 70
QSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQT     71 - 140
EGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIE    141 - 210
DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEE    211 - 280
SYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE    281 - 350
NFTADHPFLFFIRHNSSGSILFLGRFSSP                                             351 - 379
//

Text Mined References (56)

PMID Year Title