Property Summary

NCBI Gene PubMed Count 14
PubMed Score 84.26
PubTator Score 21.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.3e-11
osteosarcoma 7933 3.4e-11
medulloblastoma, large-cell 6234 4.5e-05
Disease Target Count Z-score Confidence
Diffuse large B-cell lymphoma 42 4.703 2.4

Expression

Gene RIF (8)

PMID Text
25203428 Diagnostic Utility of the Germinal Center-associated Markers GCET1, HGAL, and LMO2 in Hematolymphoid Neoplasms.
19023099 Observational study of gene-disease association. (HuGE Navigator)
18799872 serpinA9 was associated with stroke in both whites and blacks
18550480 Immunohistochemical expression of centerin further defines the germinal center cell origin of a subgroup of lymphomas.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17898315 Gcet-1 protein expression is restricted to a subset of germinal center B cells, establishing the existence of a distinct heterogeneity among normal and neoplastic germinal center B cells
17447896 The cloning, expression and molecular characterization of recombinant serpina9 (centerin) are reported.
12819018 Results report the cloning of germinal center B-cell expressed transcripts 1 and 2 (GCET1 and 2), and show that both are expressed in follicular lymphoma and diffuse large B-cell lymphoma with germinal center B-cell differentiation.

AA Sequence

MASYLYGVLFAVGLCAPIYCVSPANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFF      1 - 70
SPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKK     71 - 140
ELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKA    141 - 210
KWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMR    211 - 280
QLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSK    281 - 350
ATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS       351 - 417
//

Text Mined References (16)

PMID Year Title
25203428 2015 Diagnostic Utility of the Germinal Center-associated Markers GCET1, HGAL, and LMO2 in Hematolymphoid Neoplasms.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18799872 2008 Single nucleotide polymorphisms associated with coronary heart disease predict incident ischemic stroke in the atherosclerosis risk in communities study.
18550480 2008 Expression of the serpin centerin defines a germinal center phenotype in B-cell lymphomas.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17898315 2008 Gcet1 (centerin), a highly restricted marker for a subset of germinal center-derived lymphomas.
17447896 2007 Molecular characterization of centerin, a germinal centre cell serpin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12819018 2003 Two newly characterized germinal center B-cell-associated genes, GCET1 and GCET2, have differential expression in normal and neoplastic B cells.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11069088 2000 Identification of centerin: a novel human germinal center B cell-restricted serpin.