Property Summary

Ligand Count 28
NCBI Gene PubMed Count 89
PubMed Score 1153.05
PubTator Score 834.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Acne vulgaris 14
Acquired thrombocytopenia 8
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 23
Adrenogenital disorder 6
Allergic bronchopulmonary aspergillosis 4
Allergic conjunctivitis 22
Allergic rhinitis 94
Amenorrhea Secondary to Ovarian Dysfunction 8
Anemia in chronic kidney disease 4
Anemia of chronic renal failure 4
Angioedema 38
Ankylosing spondylitis 140
Aphthous ulcer of mouth 7
Articular gout 11
Aspiration pneumonitis 6
Asthma 385
Atopic dermatitis 952
Atrophic vaginitis 14
Autoimmune disease 5
Autoimmune hemolytic anemia 31
Bacterial conjunctivitis 10
Bacterial keratitis 5
Berylliosis 28
Bilateral Anorchia 3
Bilateral orchidectomy 3
Blepharoconjunctivitis 5
Bursitis 10
Cerebral Edema 30
Chemotherapy-Induced Hypogonadism 3
Chronic ulcerative proctitis 7
Congenital adrenal hyperplasia 73
Congenital hypoplastic anemia 8
Contact Dermatitis 81
Contraception 15
Corneal Ulcer 21
Corneal abrasion 5
Corpus Luteum Insufficiency Syndrome 8
Crohn's disease 321
Cyclitis 5
Dacryocystitis 11
Deficiency of testosterone biosynthesis 6
Delayed Puberty 97
Dermatitis herpetiformis 12
Diagnostic Test for Cushing's Syndrome 5
Discoid lupus erythematosus 7
Disorder of eye 27
Disorder of musculoskeletal system 5
Disorder of skin 5
Dysfunctional uterine bleeding 9
Edema of larynx 5
Endometrial Hyperplasia Prevention 9
Endometrial carcinoma 15
Endometriosis 540
Eosinophilic asthma 6
Epicondylitis 22
Eruption of skin 5
Erythema multiforme 17
Erythroblastic Anemia 5
Erythroderma 5
Exacerbation of asthma 11
Extrinsic allergic alveolitis 6
Fibrosis of lung 4
Follicular non-Hodgkin's lymphoma 17
Giant cell arteritis 7
Gingival Disorders 3
Granuloma annulare 5
Hemorrhoids 13
Herpes zoster keratitis 5
Hodgkin's disease 18
Hormone receptor positive malignant neoplasm of breast 10
Humoral hypercalcemia of malignancy 6
Hypogonadotropic hypogonadism 89
Hypopituitarism 40
Idiopathic thrombocytopenic purpura 5
Infection by larvae of Trichinella spiralis 3
Infective blepharitis 5
Infective otitis externa 4
Infertility Secondary to Progesterone Deficiency 8
Inflammatory bowel disease 151
Inflammatory dermatosis 3
Inhibition of lactation procedure 3
Iridocyclitis 19
Iritis 8
Itching of ear 3
Juvenile rheumatoid arthritis 111
Keratitis 62
Klinefelter's syndrome, XXY 3
LHRH Deficiency 3
Lichen simplex chronicus 7
Löffler's syndrome 5
Male hypogonadism 3
Malignant otitis externa due to Pseudomonas aeruginosa 4
Mastoidectomy Cavity Infections 3
Meibomianitis 4
Menopausal flushing 17
Miliary tuberculosis 6
Minor Bacterial Skin Infections 3
Multiple Sclerosis 540
Mycosis fungoides 29
Nephrotic Syndrome 78
Non-Hodgkin's lymphoma 22
Ocular rosacea 4
Otitis externa 10
Pemphigus 23
Plaque psoriasis 17
Pneumocystosis jiroveci pneumonia 7
Polymyalgia rheumatica 10
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 9
Postmenopausal osteoporosis 19
Prevention of Premature Labor 9
Primary Hypogonadism due to Bilateral Torsion 3
Primary Hypogonadism due to Orchitis 3
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 29
Proctitis 13
Progressive Diffuse Large B-Cell Lymphoma 4
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Punctate keratopathy 5
Recurrent herpes simplex labialis 3
Rheumatic heart disease 10
Rheumatoid arthritis 1191
Rosacea 25
Scalp psoriasis 6
Seborrheic dermatitis 31
Secondary malignant neoplasm of kidney 9
Secondary physiologic amenorrhea 32
Severe Ocular Inflammation 4
Severe adrenal insufficiency 5
Sjögren's syndrome 5
Staphylococcus Aureus Otitis Externa 4
Stevens-Johnson syndrome 92
Superficial Ocular Infection 6
Sympathetic uveitis 4
Synovitis 78
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Systemic lupus erythematosus 194
Tendinitis 14
Tenosynovitis 14
Thyroiditis 29
Tinea corporis 25
Tinea cruris 12
Tinea pedis 29
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protein reaction 5
Transplanted organ rejection 10
Undescended testicle 3
Uveitis 103
psoriasis 6694
sarcoidosis 370
ulcerative colitis 1819
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.8
Disease Target Count Z-score Confidence
Cushing's syndrome 48 4.287 2.1

Expression

Gene RIF (49)

AA Sequence

MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSI      1 - 70
SMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELL     71 - 140
ESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQP    141 - 210
FDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAAL    211 - 280
SRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAV    281 - 350
LQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV                   351 - 405
//

Text Mined References (91)

PMID Year Title