Property Summary

NCBI Gene PubMed Count 173
PubMed Score 812.65
PubTator Score 867.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.200 5.6e-32

 OMIM Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (100)

AA Sequence

MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD      1 - 70
KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA     71 - 140
MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY    141 - 210
IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPD    211 - 280
QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR    281 - 350
NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP    351 - 420
KQA                                                                       421 - 423
//

Text Mined References (175)

PMID Year Title