Property Summary

NCBI Gene PubMed Count 170
PubMed Score 803.84
PubTator Score 867.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.200 5.6e-32

 OMIM Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (98)

PMID Text
26908325 AACT is downregulated in NSCLC. The GlcNAcylated AACT can effectively differentiate Stage I non-small cell lung cancer from healthy or benign lung disease samples.
26210716 The ACT gene (also named SERPINA3) was mapped on chromosome 14q32.1 We studied the association between Alpha-1 antichymotrypsin (ACT) signal peptide A/T polymorphism polymorphism and risk of primary intracerebral hemorrhage
25170552 Proteome demonstration of alpha-1-acid glycoprotein and alpha-1-antichymotrypsin candidate biomarkers for diagnosis of enterovirus 71 infection
24817931 SERPINA3 promotes endometrial cancer cells growth by regulating G2/M cell cycle checkpoint and apoptosis.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of serpin peptidase inhibitor, clade A, member 3 (SERPINA3) in primary human brain microvascular endothelial cells
23867815 Microarray analysis indicates HIV-1 Tat-induced upregulation of serpin peptidase inhibitor, clade A, member 3 (SERPINA3) in primary human brain microvascular endothelial cells
22869038 This study demonistrated that SERPINA3 is changed in the dorsolateral prefrontal cortex of individuals with schizophrenia
22806587 Prostate specific antigen (PSA) forms complexes with alpha1-antichymotrypsin (ACT) within the prostate, which may explain, at least partially, why the ratio of serum PSA-ACT to total PSA is increased in prostate cancer.
22294107 The common alpha1-antichymotrypsin signal peptide -15A/T polymorphism may not be a major risk factor for Alzheimer disease (AD) but the polymorphism is capable of increasing late onset AD risk. [Meta-analysis]
22272609 ACT-17 variation presents a risk factor for Alzheimer's disease in the worldwide population, especially in the Caucasian population.
22246292 the promoter of SERPINA3 is transcriptionally activated by three transcription factors (SP1, MZF1 and ZBTB7B)
21730889 alpha-1 antichymotrypsin C-terminal fragment and Apo A1 provide a plasma molecular profile, and this is associated with acute cellular renal allograft rejection.
21693707 Pivotal role for alpha1-antichymotrypsin in skin repair
21296644 human plasma serine protease inhibitor alpha(1)-antichymotrypsin inhibits staphopain C
21067581 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20444200 The Alpha 1 antichymotrypsin is an independent histological prognostic marker for patients with Melanoma, especially those with Stage III melanoma.
20378355 The study concluded that the effect of the variations in the alpha-1-antichymotrypsin regulatory region must be very limited.
20302328 Found a marked and persistent coronary artery bypass grafting (CABG) postoperative increase in the levels of the serpin-protease inhibitor alpha(1)-antichymotrypsin that fully maintains the inhibitory activity blunting its protease substrate cathepsin G.
20158662 No cirrhosis secondary to ACT deficiency has been reported in children.
20117085 AAT efficiently inhibits both heat- and chemical-induced aggregation of various test proteins.
19959196 The ANTICHYMOTRYPSIN genotype and allele frequency are not different in Indian cerebral hemorrhage and cerebral ischemia compared to controls.
19959196 Observational study of gene-disease association. (HuGE Navigator)
19933216 Meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19907165 The rs4934 polymorphism of SERPINA3 is not associated with sporadic intracranial aneurysms among individuals of Chinese Han ethnicity.
19907165 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19590686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19525388 Ox-ACT promotes release of human monocyte chemoattractant protein-1 (MCP-1) and IL-8 from human lung type epithelial cells (A549) and normal human bronchial epithelial (NHBE) cells
19390575 Observational study of gene-disease association. (HuGE Navigator)
19341158 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19008959 Meta-analysis of gene-disease association. (HuGE Navigator)
18991685 increased peripheral ACT levels in APOE 4 positive patients appear to predict an accelerated clinical progression
18842294 Observational study of gene-disease association. (HuGE Navigator)
18408372 Our study did not show an association between alpha-1 antichymotrypsin signal peptide A/T polymorphism and primary intracerebral hemorrhage.
18408372 Observational study of gene-disease association. (HuGE Navigator)
18401426 Alpha-1-antichymotrypsin is a pathophysiologic inhibitor that controls MMP-9 activation in skin tissue.
18383875 A correlation of PSA levels and the alpha 1 antichymotrypsin genotype in young prostate carcinoma patients was found.
18383875 Observational study of gene-disease association. (HuGE Navigator)
18248459 Nur77 overexpression and RNA interference-mediated Nur77 gene knockdown analysis confirmed that SerpinA3 is indeed a novel Nur77-targeted gene.
18078695 We conclude that APOE is a risk gene for amnestic mild cognitive impairment and that ACT and CHRNA7 may act in these patients as modifier genes for the time of progression to Alzheimer's disease.
18078695 Observational study of gene-disease association. (HuGE Navigator)
18056971 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18056971 acute myocardial infarction from information on functional gene variants that favor inflammation or modulate cholesterol metabolism: IL6 -174 G/C, TNF -308 G/A, IL10 -1082 G/A, SERPINA3 -51 G/T, IFNG +874 T/A, HMGCR -911 C/A, and APOE epsilon2/3/4
17854420 Meta-analysis of gene-disease association. (HuGE Navigator)
17690329 Observational study of gene-disease association. (HuGE Navigator)
16968986 Observational study of gene-disease association. (HuGE Navigator)
16565071 NFI-X cooperates with (activator protein 1)AP-1 by an unknown mechanism in astrocytes, which results in the expression of a subset of astrocyte-specific genes.
16453284 Observational study of gene-disease association. (HuGE Navigator)
16424370 Observational study of gene-disease association. (HuGE Navigator)
16424370 SERPINA3 polymorphism does not have a role in primary intracerebral hemorrhage in a Polish population
16303762 AP-1 is a key transcription factor that, in part, controls astrocyte-specific expression of genes including the ACT and GFAP genes
16278826 Observational study of gene-disease association. (HuGE Navigator)
16137793 Observational study of gene-disease association. (HuGE Navigator)
15935385 Observational study of gene-disease association. (HuGE Navigator)
15935385 This study findings suggest that ACT polymorphism (A/T) is a risk factor for post-stroke dementia.
15907346 Observational study of gene-disease association. (HuGE Navigator)
15907346 The onset of MSA was significantly earlier and the disease progressed significantly faster in patients with ACT-AA genotype than in those with non-ACT-AA genotypes. The ACT concentration in cerebrospinal fluid was increased in patients with ACT-AA.
15718509 Observational study of gene-disease association. (HuGE Navigator)
15718509 the A/T polymorphism of SERPINA3 gene is associated with the risk factor for aneurysmal subarachnoid hemorrhage
15659365 serpin/furin complex stability depends on pH and regulation at the deacylation step
15653173 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15653173 The ACT TT promoter genotype was associated with an increased risk of EOAD independently from the presence of the apolipoprotein E (APOE) epsilon 4 allele.
15612581 Observational study of gene-disease association. (HuGE Navigator)
15546506 Multivariate analysis showed that ACT mRNA level, but not STC2 mRNA level, in HR-positive patients, was a significant prognostic factor (P = 0.042), which was independent of tumor size and lymph node metastases.
15542006 Observational study of gene-disease association. (HuGE Navigator)
15542006 Alpha1-antichymotrypsin-AA may confer a modest protection against developing early-onset Parkinson disease in women
15530656 overexpression of ACT by astrocytes could thus contribute to increased beta-amyloid fibril formation in Alzheimer's disease
15482730 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15159602 Observational study of gene-disease association. (HuGE Navigator)
12782964 Observational study of gene-disease association. (HuGE Navigator)
12736093 Observational study of gene-disease association. (HuGE Navigator)
12685871 Observational study of gene-disease association. (HuGE Navigator)
12600202 Polymeric AACT specifically seeds the polymerization of native protein by a serpin-dependent process that occurs under physiological conditions and may be important in the deposition of AACT in plaques in patients with Alzheimer's disease.
12324297 alpha(1)-antitrypsin and antichymotrypsin are produced by the mammary gland and are present in milk in relatively high amounts in early lactation
12126519 Observational study of gene-disease association. (HuGE Navigator)
12023832 Gene regulation of the serine proteinase inhibitors alpha1-antitrypsin and alpha1-antichymotrypsin.
11992569 Observational study of gene-disease association. (HuGE Navigator)
11992569 data suggested that the ApoE epsilon2/epsilon4 genotype might be a susceptibility variant of moderate effect for sporadic idiopathic Parkinson disease in our samples, whereas the ACT gene signal peptide polymorphism might not
11959399 Observational study of gene-disease association. (HuGE Navigator)
11959399 significantly higher in plasma of Alzheimer patients compared to controls
11936240 no association seen between alpha 1-antichymotrypsin and time to psychosis in Alzheimer's disease
11916200 Observational study of gene-disease association. (HuGE Navigator)
11798857 A25G and G39A substitutions in the AACT gene are probably one of the risk factors to Alzheimer's disease (AD) in Han Chinese.
11769703 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11692021 Observational study of gene-disease association. (HuGE Navigator)
11692021 alpha(1)-antichymotrypsin polymorphism: a risk factor for hemorrhagic stroke in normotensive subjects.
11385264 Observational study of gene-disease association. (HuGE Navigator)
11295654 Observational study of gene-disease association. (HuGE Navigator)
11290389 Observational study of gene-disease association. (HuGE Navigator)
11289720 Observational study of gene-disease association. (HuGE Navigator)
11161981 Observational study of gene-disease association. (HuGE Navigator)
11132933 Observational study of gene-disease association. (HuGE Navigator)
11099722 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD      1 - 70
KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA     71 - 140
MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY    141 - 210
IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPD    211 - 280
QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR    281 - 350
NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP    351 - 420
KQA                                                                       421 - 423
//

Text Mined References (172)

PMID Year Title
26908325 2016 Identification of GlcNAcylated alpha-1-antichymotrypsin as an early biomarker in human non-small-cell lung cancer by quantitative proteomic analysis with two lectins.
26210716 2015 Is Alpha-1 Antichymotrypsin Gene Polymorphism a Risk Factor for Primary Intracerebral Hemorrhage? A Case-Control Study and Meta-Analysis.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25170552 2015 Proteome demonstration of alpha-1-acid glycoprotein and alpha-1-antichymotrypsin candidate biomarkers for diagnosis of enterovirus 71 infection.
24817931 2014 SERPINA3 promotes endometrial cancer cells growth by regulating G2/M cell cycle checkpoint and apoptosis.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22869038 2013 Increased inflammatory markers identified in the dorsolateral prefrontal cortex of individuals with schizophrenia.
22806587 2013 PSA forms complexes with ?1-antichymotrypsin in prostate.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22294107 2012 Association between ?1-antichymotrypsin signal peptide -15A/T polymorphism and the risk of Alzheimer's disease: a meta-analysis.
22272609 2013 The association of ACT -17 A/T polymorphism with Alzheimer's disease: a meta-analysis.
22246292 2012 Genetic and epigenetic mechanisms collaborate to control SERPINA3 expression and its association with placental diseases.
21730889 2011 Apolipoprotein A1 and C-terminal fragment of ?-1 antichymotrypsin are candidate plasma biomarkers associated with acute renal allograft rejection.
21693707 2011 Pivotal role for alpha1-antichymotrypsin in skin repair.
21296644 2011 ?1-Antichymotrypsin inactivates staphylococcal cysteine protease in cross-class inhibition.
21067581 2010 Polymorphism of SERPINE2 gene is associated with pulmonary emphysema in consecutive autopsy cases.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20444200 2010 Alpha 1 antichymotrypsin is aberrantly expressed during melanoma progression and predicts poor survival for patients with metastatic melanoma.
20378355 2010 Is there an association of regulatory region polymorphism in the alpha-1-antichymotrypsin gene with sporadic Alzheimer's disease in the northern Han-Chinese population?
20302328 2010 Proteomic analysis of plasma from patients undergoing coronary artery bypass grafting reveals a protease/antiprotease imbalance in favor of the serpin alpha1-antichymotrypsin.
20158662 2010 alpha(1)-Antichymotrypsin deficiency associated with liver cirrhosis.
20117085 2010 Inhibition of heat- and chemical-induced aggregation of various proteins reveals chaperone-like activity of the acute-phase component and serine protease inhibitor human alpha(1)-antitrypsin.
19959196 2010 A study of alpha1 antichymotrypsin gene polymorphism in Indian stroke patients.
19933216 2010 The COPD genetic association compendium: a comprehensive online database of COPD genetic associations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19907165 2010 Polymorphism rs4934 of SERPINA3 and sporadic intracranial aneurysms in the Chinese population.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19590686 2009 Postural changes in blood pressure associated with interactions between candidate genes for chronic respiratory diseases and exposure to particulate matter.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19525388 2009 Oxidized {alpha}1-antitrypsin stimulates the release of monocyte chemotactic protein-1 from lung epithelial cells: potential role in emphysema.
19390575 2009 Lung cancer susceptibility model based on age, family history and genetic variants.
19341158 2009 Analysis of candidate genes and hypertension in African American adults.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19008959 2008 The genetics of primary haemorrhagic stroke, subarachnoid haemorrhage and ruptured intracranial aneurysms in adults.
18991685 2008 Elevated plasma levels of alpha-1-anti-chymotrypsin in age-related cognitive decline and Alzheimer's disease: a potential therapeutic target.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18408372 2008 Alpha-1 antichymotrypsin gene signal peptide a/t polymorphism and primary intracerebral hemorrhage.
18401426 2008 Proteolytic activation of matrix metalloproteinase-9 in skin wound healing is inhibited by alpha-1-antichymotrypsin.
18383875 Alpha 1 antichymotrypsin genotype is associated with increased risk of prostate carcinoma and PSA levels.
18248459 2008 Alpha 1-antichymotrypsin/SerpinA3 is a novel target of orphan nuclear receptor Nur77.
18078695 2009 APOE, ACT and CHRNA7 genes in the conversion from amnestic mild cognitive impairment to Alzheimer's disease.
18056971 2007 Acute myocardial infarction and proinflammatory gene variants.
17854420 2008 Meta-analysis of genetic variability in the beta-amyloid production, aggregation and degradation metabolic pathways and the risk of Alzheimer's disease.
17690329 2008 IL10 polymorphisms are associated with airflow obstruction in severe alpha1-antitrypsin deficiency.
17608807 2007 The loss of tryptophan 194 in antichymotrypsin lowers the kinetic barrier to misfolding.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16968986 2007 The alanine/threonine polymorphism of the alpha-1-antichymotrypsin (SERPINA3) gene and ruptured intracranial aneurysms in the Japanese population.
16892178 2006 Differentiation of human embryonic stem cells into hepatocytes in 2D and 3D culture systems in vitro.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16565071 2006 Nuclear factor-1-X regulates astrocyte-specific expression of the alpha1-antichymotrypsin and glial fibrillary acidic protein genes.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16453284 2006 Reproducible genetic associations between candidate genes and clinical knee osteoarthritis in men and women.
16424370 2006 SERPINA3 polymorphism is not associated with primary intracerebral hemorrhage in a Polish population.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16303762 2006 Astrocyte-specific expression of the alpha1-antichymotrypsin and glial fibrillary acidic protein genes requires activator protein-1.
16278826 2006 Cryptic haplotypes of SERPINA1 confer susceptibility to chronic obstructive pulmonary disease.
16137793 2006 Alpha-1-antichymotrypsin (ACT or SERPINA3) polymorphism may affect age-at-onset and disease duration of Alzheimer's disease.
15935385 2005 Post-stroke dementia is associated with alpha(1)-antichymotrypsin polymorphism.
15907346 2005 Alpha-1-antichymotrypsin gene polymorphism and susceptibility to multiple system atrophy (MSA).
15718509 2005 Alpha1-antichymotrypsin gene (SERPINA3) A/T polymorphism as a risk factor for aneurysmal subarachnoid hemorrhage.
15659365 2005 Stability of mutant serpin/furin complexes: dependence on pH and regulation at the deacylation step.
15653173 2005 A new promoter polymorphism in the alpha-1-antichymotrypsin gene is a disease modifier of Alzheimer's disease.
15638460 2004 Expression patterns of murine antichymotrypsin-like genes reflect evolutionary divergence at the Serpina3 locus.
15612581 [Complex search for antiprotease-protease enzyme gene polymorphisms in patients with chronic obstructive pulmonary diseases].
15546506 2004 mRNA expression level of estrogen-inducible gene, alpha 1-antichymotrypsin, is a predictor of early tumor recurrence in patients with invasive breast cancers.
15542006 2004 The homozygote AA genotype of the alpha1-antichymotrypsin gene may confer protection against early-onset Parkinson's disease in women.
15530656 2004 Allele-specific overexpression in astrocytes of an Alzheimer's disease associated alpha-1-antichymotrypsin promoter polymorphism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15482730 2004 [ACT/AA polymorphism could duplicate the APOE*epsilon4-associated Alzheimer's disease risk].
15159602 2004 Apolipoprotein E and alpha-1-antichymotrypsin polymorphisms in sporadic inclusion body myositis.
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14687906 2004 Complex formation between human kallikrein 13 and serum protease inhibitors.
14668352 2004 The SANT2 domain of the murine tumor cell DnaJ-like protein 1 human homologue interacts with alpha1-antichymotrypsin and kinetically interferes with its serpin inhibitory activity.
12782964 2003 Joint analysis of candidate genes related to Alzheimer's disease in a Spanish population.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12736093 2003 Apolipoprotein E, angiotensin-converting enzyme and alpha-1-antichymotrypsin genotypes are not associated with post-stroke dementia.
12709365 2003 Purification of human kallikrein 6 from biological fluids and identification of its complex with alpha(1)-antichymotrypsin.
12685871 2002 Lack of association of alpha-1 antichymotrypsin gene polymorphism with PR3-ANCA and MPO-ANCA associated vasculitis.
12600202 2003 Nucleation of alpha 1-antichymotrypsin polymerization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475184 2002 Glioma cell activation by Alzheimer's peptide Abeta1-42, alpha1-antichymotrypsin, and their mixture.
12324297 2002 Alpha(1)-antitrypsin and antichymotrypsin in human milk: origin, concentrations, and stability.
12126519 2002 [Association between alpha-1-antichymotrypsin gene polymorphism and cerebral hemorrhage].
12023832 2002 Gene regulation of the serine proteinase inhibitors alpha1-antitrypsin and alpha1-antichymotrypsin.
11992569 2002 Genetic study of apolipoprotein E gene, alpha-1 antichymotrypsin gene in sporadic Parkinson disease.
11959399 Distribution of plasma alpha 1-antichymotrypsin levels in Alzheimer disease patients and controls and their genetic controls.
11936240 2002 Apolipoprotein E and alpha-1-antichymotrypsin genotypes do not predict time to psychosis in Alzheimer's disease.
11916200 2002 Alpha1-antitrypsin genotypes in patients with chronic pancreatitis.
11835318 2002 Alpha1-antichymotrypsin/Alzheimer's peptide Abeta(1-42) complex perturbs lipid metabolism and activates transcription factors PPARgamma and NFkappaB in human neuroblastoma (Kelly) cells.
11769703 2001 [Association between polymorphism of alpha 1-antichymotrypsin and apolipoprotein E gene and Parkinson's disease in Shanghai Hans].
11735417 2001 Characterization of hK4 (prostase), a prostate-specific serine protease: activation of the precursor of prostate specific antigen (pro-PSA) and single-chain urokinase-type plasminogen activator and degradation of prostatic acid phosphatase.
11692021 2001 alpha(1)-antichymotrypsin polymorphism: a risk factor for hemorrhagic stroke in normotensive subjects.
11385264 2001 Genetic association analysis of alpha-1-antichymotrypsin polymorphism in Parkinson's disease.
11317942 2000 Characterization and determination of the complex between prostate-specific antigen and alpha 1-protease inhibitor in benign and malignant prostatic diseases.
11295654 2001 Chromosome 14 linkage analysis and mutation study of 2 serpin genes in allergic asthmatic families.
11290389 2001 Alpha-1 antichymotrypsin and alpha-2 macroglobulin gene polymorphisms are not associated with Korean late-onset Alzheimer's disease.
11289720 2001 alpha-1-Antichymotrypsin gene A1252G variant (ACT Isehara-1) is associated with a lacunar type of ischemic cerebrovascular disease.
11274154 2001 alpha 1-Antichymotrypsin is the human plasma inhibitor of macrophage ectoenzymes that cleave pro-macrophage stimulating protein.
11161981 2001 A linkage disequilibrium between genes at the serine protease inhibitor gene cluster on chromosome 14q32.1 is associated with Wegener's granulomatosis.
11132933 2000 Increased frequency of the alpha-1-antichymotrypsin T allele in cerebral amyloid angiopathy.
11099722 2000 Genetic risk factors of sporadic Alzheimer's disease among Chinese in Taiwan.
11096092 2001 alpha 1-Proteinase inhibitor, alpha 1-antichymotrypsin, and alpha 2-macroglobulin are the antiapoptotic factors of vascular smooth muscle cells.
10829039 2000 c-erbB-2 is of independent prognostic relevance in gastric cancer and is associated with the expression of tumor-associated protease systems.
10759471 2000 Analysis of free prostate-specific antigen (PSA) after chemical release from the complex with alpha(1)-antichymotrypsin (PSA-ACT).
10660528 2000 DNA strongly impairs the inhibition of cathepsin G by alpha(1)-antichymotrypsin and alpha(1)-proteinase inhibitor.
10618372 2000 Inactive conformation of the serpin alpha(1)-antichymotrypsin indicates two-stage insertion of the reactive loop: implications for inhibitory function and conformational disease.
10512690 1999 Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.
10228625 1999 Decreased chymase activity is associated with increased levels of protease inhibitors in mast cells of psoriatic lesions.
10209959 1999 Prostatic human kallikrein 2 inactivates and complexes with plasminogen activator inhibitor-1.
10048303 1998 Inflammation, antichymotrypsin, and lipid metabolism: autogenic etiology of Alzheimer's disease.
9880565 1999 Molecular studies define the primary structure of alpha1-antichymotrypsin (ACT) protease inhibitor in Alzheimer's disease brains. Comparison of act in hippocampus and liver.
9824262 1998 Effects of serpins on cholesterol crystallization in model bile.
9698370 1998 Kinetic mechanism of the inhibition of cathepsin G by alpha 1-antichymotrypsin and alpha 1-proteinase inhibitor.
9635374 1998 Acetaldehyde inhibits chymotrypsin and serum anti-chymotrypsin activity.
9580375 1998 Alpha-1 antichymotrypsin levels are actively increased in normal colostrum.
9521649 1998 Engineering an anion-binding cavity in antichymotrypsin modulates the "spring-loaded" serpin-protease interaction.
9428387 1998 Human glandular kallikrein, hK2, shows arginine-restricted specificity and forms complexes with plasma protease inhibitors.
9261179 1997 Characterization of the precursor of prostate-specific antigen. Activation by trypsin and by human glandular kallikrein.
9042371 1997 Purification of enzymatically active kallikrein hK2 from human seminal plasma.
8849841 1996 Cathepsin G in gingival tissue and crevicular fluid in adult periodontitis.
8836107 1996 Arginine substitutions in the hinge region of antichymotrypsin affect serpin beta-sheet rearrangement.
8739078 1996 Prostate specific antigen--a new constituent of breast cyst fluid.
8732755 1996 Structural investigation of the alpha-1-antichymotrypsin: prostate-specific antigen complex by comparative model building.
8718849 1996 Structural change in alpha-chymotrypsin induced by complexation with alpha 1-antichymotrypsin as seen by enhanced sensitivity to proteolysis.
8647626 1996 Characterisation of the tumour-associated carbohydrate epitope recognised by monoclonal antibody 4D3.
8376411 1993 Purification and characterization of alpha 1-antichymotrypsin-like protease inhibitor that regulates prohormone thiol protease involved in enkephalin precursor processing.
8365378 1993 alpha 1-Antitrypsin- and anchorage-independent growth of MCF-7 breast cancer cells.
8267879 1993 A novel chymotrypsin-like serine proteinase from human lung.
8244391 1993 A leucine-to-proline substitution causes a defective alpha 1-antichymotrypsin allele associated with familial obstructive lung disease.
8226889 1993 Reaction of human chymase with reactive site variants of alpha 1-antichymotrypsin. Modulation of inhibitor versus substrate properties.
8216224 1993 Interaction of activated protein C with serpins.
8011628 1994 Conversion of alpha 1-antichymotrypsin into a human neutrophil elastase inhibitor: demonstration of variants with different association rate constants, stoichiometries of inhibition, and complex stabilities.
7966721 1994 High resolution 2-dimensional electrophoretic analysis of proteins in saline bladder washings.
7924407 1994 Alpha 1-antichymotrypsin is present in and synthesized by the cornea.
7873202 1995 Human neutrophil defensin and serpins form complexes and inactivate each other.
7759598 1995 Presence, activities, and molecular forms of cathepsin G, elastase, alpha 1-antitrypsin, and alpha 1-antichymotrypsin in bronchiectasis.
7588564 1995 Biological activity of prostate-specific antigen isolated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and electroelution.
7528097 1994 Immunohistochemical localization of serine-protease inhibitors in the human placenta.
7521171 1994 Interactions of alpha-1-antichymotrypsin, alpha-1-proteinase inhibitor, and alpha-2-macroglobulin with the fungal enzyme, seaprose.
6762318 1982 Analysis of the tissue and cellular localization of alpha-1-antichymotrypsin by an immunohistochemical technique.
6687683 1983 Structural alterations in alpha 1-antichymotrypsin from normal and acute phase human plasma.
6606438 1983 Sequence homology between human alpha 1-antichymotrypsin, alpha 1-antitrypsin, and antithrombin III.
6556193 1983 Amino acid sequence at the reactive site of human alpha 1-antichymotrypsin.
6547997 1984 Plasma protease inhibitors in mouse and man: divergence within the reactive centre regions.
3637050 1986 Inhibitors of trypsin, chymotrypsin and elastase in human uterine fluid.
3492865 1986 Familial alpha 1-antichymotrypsin deficiency.
3490907 1986 Inhibition of human DNA polymerase alpha by alpha 1-antichymotrypsin.
3485824 1986 Regional location of alpha 1-antichymotrypsin and alpha 1-antitrypsin genes on human chromosome 14.
3260956 1988 Cloning of the human alpha 1 antichymotrypsin gene and genetic analysis of the gene in relation to alpha 1 antitrypsin deficiency.
3257719 1988 Immunochemical identification of the serine protease inhibitor alpha 1-antichymotrypsin in the brain amyloid deposits of Alzheimer's disease.
3028924 1986 Proteinase inhibitors in the kidney and its tumours.
2945424 1986 Acute leukemias with both myeloid and lymphoid surface markers. Cytoplasmic alpha-1-anti-chymotrypsin and alpha-1-anti-trypsin as possible indicators of early granulocytic differentiation.
2787670 1989 The microheterogeneity of desialylated alpha 1-antichymotrypsin: the occurrence of two amino-terminal isoforms, one lacking a His-Pro dipeptide.
2456771 1988 Interactions in vitro and in vivo between human and porcine cationic pancreatic elastase and plasma protease inhibitors.
2435303 1987 "In vivo" and "in vitro" inhibition of human pancreatic chymotrypsin A by serum inhibitors.
2432851 1987 The osteoclast-type giant cell tumor of the pancreas.
2404007 1990 Cloning, expression, purification, and biological activity of recombinant native and variant human alpha 1-antichymotrypsins.
2190106 Alpha 1-antichymotrypsin is associated solely with amyloid deposits containing the beta-protein. Amyloid and cell localization of alpha 1-antichymotrypsin.
2016749 1991 Crystal structure of cleaved human alpha 1-antichymotrypsin at 2.7 A resolution and its comparison with other serpins.
1618300 1992 Detection of a new mutant alpha-1-antichymotrypsin in patients with occlusive-cerebrovascular disease.
1351206 1992 Mis-sense mutation of alpha 1-antichymotrypsin gene associated with chronic lung disease.
1311327 1992 Proteolytic inactivation of alpha 1-proteinase inhibitor and alpha 1-antichymotrypsin by oxidatively activated human neutrophil metalloproteinases.